Bilderberg.org

Checking...
Bilderberg Nazi roots censored by Wikipedia StratCom hackers - https://37.220.108.147/members/www.bilderberg.org/ www.bilderberg-mirror.org.uk High Priests of Globalisation - Bilderberg Conferences - parasitic NATO Mafia P2 style governmnent of power elit
Low trust score
 | 
Add a review Change category Claim this site
bilderberg, bildenberg, bilderburg, bilderberger, illuminati, tony, gosling, money, nazi, bormann, hitler, power, club, greed, banking, bank, banks, media, occult, secret, society, steering, group, conferences, meetings, secrecy, globalisation, globalization, globalists, globalism, social, control, environment, transnational, corporations, tnc, new, world, order, public, transport, freedom, speech, free, press, elites, global, elite, cultural, manipulators, tyranny, world government, politics, spiritual, bbc, corruption, manipulation, disinformation, oil, companies, multinationals, multinational corporations, world bank, imf, mi5, nsa, mi6, intelligence, solidarity, fighters, noam, chomsky, eco, warriors, land rights, freemasons, masons, h bomb, trilateral commission, tony gosling, economic warfare, hidden agenda, justice, social justice, economic justice, the enemy wxª meta name  Show all keywords

Bilderberg.org Free SEO Report

Website Inpage Analysis for Bilderberg.org

H1 Headings

14 :
  1. How to mirror this website:
  2. www.bilderberg.org - site index:
  3. Bilderberg Conferences
  4. Other Western Élites
  5. The Oil Industry and Destruction of Public Transport
  6. Culture, Communication and Control
  7. Fascism, State Terror and Power Abuse
  8. Quark, Strangeness and Charm
  9. Doubletake: hidden history
  10. Personal but not private
  11. There is another way
  12. Intro to the site
  13. Threats to this site:
  14. What you can do:

H2 Headings

5 :
  1. Free translation of this page
  2. 3. Hacking, trojans and viruses
  3. 4. Delisting or downlisting by search engines
  4. 5. Content removal by Google search engine
  5. Can you help secure my research?

H3 Headings

52 :
  1. "The High Priests of Globalisation"Will HuttonTransatlantic power élite's secret Bilderberg conferences & state terror research since 1996 from Bristol, EnglandOfficial Bilderberg PR website is here - Bilderberg.org press. Please mirror this site if you can (Fixed IP site & forum). "The only thing necessary for the triumph of evil is for good men to do nothing" - Edmund Burke Bristol MP 1774-1780
  2. Press TV, News, Radio shows (1) + (2), YouTube channels, Twitter + archive 1, 2, 3, 4... 9/11, land rights & Bilderberg email lists + column My talks: The War isn't Meant to be Won (2017), When Propaganda Stops Working (2016), News or Theatre? (2015), Revolutionary Acts of Journalism (2014)THE TRAITORS OF ARNHEM? My Bilderberg origins TALK in Oosterbeek, 22 Sep 2018 - Pompeo sneaks into Bilderberg 2019 at MontreuxA Bridge Not Far: Bilderberg spawned in Nazis' Sep1944 Oosterbeek Hexenkessel - Operation Market Garden's 3 Bilderberg 'coincidences'
  3. Charles, Prince Regent: A Ticking Time Bomb? Charles Will Become Head Of State In April 2021 But Queen Elizabeth Won't 'Abdicate'  03Jun20 - The Mahogany Box: Diana's Secret Tapes About Prince Charles' Scandals & Palace Rape Entrusted To Paul Burrell02Jun20 - The Paris London Connection: John Morgan's Summary Of The MI6 Assassination Of Princess Diana. Inquest & Police InvestigationBrexit news - ex-Bilderberg bigwig Ken Clarke MP ejected from Conservative partyMay 1945: Churchill's secret deal with Hitler's treasurer Bormann for a share in $1bn in Fourth Reich Nazi loot -> The timeline   editions of Here and Now magazine - in tribute to Bilderberg paper author Prof. Mike Peters who wrote for it  BETA BILDERBERG.ORG WORDPRESS -> IS HERE Bilderberg Jun 2018: 7-10th June, NH Torino Lingotto Congress, Turin, Italy - Davos 2018 explainer (Daily Mirror)22May2019 eBook - CHRISTCHURCH MASSACRE: AND JOHN PODESTA by John D. Philman in open docx and PDF15Jan2016 eBook - BANKING PIRATES OF THE CITY OF LONDON by John D. Christian in Word DOC and PDF  
  4.  1900hrs 20 Sep 1944, Nijmegen. Can British army reach Arnhem despite Bilderberg traitors? My scenarios for two Market Garden wargamesFIRST they came for the Muslims - THEN they came for the unembedded journalists - THEN they came 4 the travellers -> top news sites
  5.  RT | Nukes | History
  6. Feb17 - Martin Bormann & Nazi survival: Allied/Nazi traitors in 'Marilyn, Hitler and Me, The memoirs of Milton Shulman' (1998) Bilderberg 2017: 1-4 June, Chantilly, Virginia, USA - Bilderberg 2016 EXCLUSIVES recorded in Dresden 1, 2, 3, 4, 5, 6 & masterclass TERRORISM EXPERT: I worked 1989-90 at BBC GLR on IRA London bombs - and dissected the 2005, 7/7 London Bombings for the 10th anniversary My Dec 2016 eschatology presentation - The Traitor of Arnhem by Lt. Col. Oreste Pinto - Nazi agent in partisans betrays Market Garden causing Oosterbeek WWII slaughter first Bilderberg meeting site - Churchill's Bomb by Graham Farmelo - What the BBC won't tell you about BREXIT
  7. Free Publicity! Hatchet jobs on me in Daily Beast and Washington Post - See vids above /\ plus... Tyrol Bilderberg 2015 'Kiss of death' for neutral Austria? briefing by myself and Martin Summers: Bilderberg forum news & contextual feed for June 11-14 2015 Bilderberg meeting in Tyrol, Austria - Charlie Hebdo Paris attacks: NATO false flag terrorism and the historical picture [.mp3] - Bilderberg 2014 on Ukraine: military chiefs, arms bosses and billionaire speculators ... Charlie Skelton's Bilderblog - Copenhagen May-June 2014 - My Bilderberg 2013 talk - Missing Malaysian MH370 - Top Italian judge publishes evidence of Bilderberg commissioning terrorist attacks
  8. Kiev's Neo-Nazi coup as Ukraine caught in tug-of-war between NATO & Russia - GCHQ use Orwell's 'Telescreens' - Death & Masonic Corruption at Gloucestershire's Cotswold Water Park - My articles from Bristol Indymedia - JFK 50th (full coverage): The Garrison Interview (1988) Guns & Butter + William Cooper: JFK sacrificed to priesthood of the 'old gods' - WWF, Bilderberg & The Silence Of The Pandas -First step to microchipping the population? Julie Beal: Digital ID For All UK Citizens starting with the poor - Cameron wants UK police state, declares war on press, defends NSA GCHQ criminal data trawls - Killing journalism: 1st private company providing psychological warfare services, or 'PsyOps', on the open market - Award winning US investigative journalist Michael Hastings was investigating CIA Director Paul Brennan's DOMESTIC PsyOps when his 'smart' Mercedes 'crashed', killing him - British journalist in Argentina discovers photo of Hitler's deputy Martin Bormann's 1953 born daughter: read Manning & Op JB - Forget the Bank of Canada, Mark Carney's REAL pro-Nazi employer - Churchill, Morton, Fleming, George VI, Mountbatten's 1945 sell-out? - Roger Cook: How Murdoch killed The Cook Report's WWIII Watch: Does Iran already have ex SS20 Thermonuclear Warheads? - Dark forces' centuries old power network
  9.  Revelation chronology......timeline for the future? War & black magic special: Dennis Wheatley: Magic and the Fate of Nations - In World War the devil 'has surpassed himself' - Dennis Wheatley: New World Order 'is another name for hell' - Christ's protection - George Bruce: Nazi black magic & the anti-christ order - Stephen Knight: Is freemasonry satanic? - Geoff Hoon's secret prison
  10. Historic Illuminati source material: 1. Code of the Illuminati by Abbé Barreul, 1798; 2. Proofs of a Conspiracy by Dr John Robison, 1794 - Saville report: Former Bilderberg Chairman Peter Carrington responsible for 1972 Bloody Sunday massacre? - Ergenekon: Turkey prosecutes Mossad coup plotters - Operation Gladio documentaries: NATO's Secret Armies (2009) BBC Timewatch (1993), understanding the NATO/Nazi threat to our world - Antichrist & the Green Prince by John D. Christian - Was enclosure the true cause of English Civil War? - Late great Allan Francovich: CIA is 'a kind of Rotary Club version of the Gestapo' - Full texts of 1st, 2nd, 3rd degree & Royal Arch masonic initiation rites
  11. Top Italian judge publishes evidence of Bilderberg commissioning terrorist attacks - We Are Change's Luke Rudowski sent child porn images under cover of 'Bilderberg leak' - PRISM surveillance has broken the criminal law - so what do GCHQ & the MoD do? Launch a massive cover-up under the guise of 'National Security' - Charge Sheet: 1991-2012 Logan Act crimes & breaches of UK Parliamentary Code by UK Government Minister Kenneth Clarke & other Bilderberg politicians (PDF) - The first ever Bilderberg Fringe Festival on Sat 8th & Sun 9th June 2013 in Hertfordshire - Former Scotland Yard detective: Banging Up The Banksters - No. 1 Bilderberg investigative journalist 'Big' Jim Tucker [video] dies aged 78 - Boston marathon bombing patsies killed/maimed by FBI? - Israeli PR team rushes in to aid FBI - Bilderberg 2013: 5-9th June, Watford, Rothschildshire, UK? - Victor Rothschild behind Margaret Thatcher's sacking of BBC DG, Poll Tax and MI5/MI6 appointments - 2 meltdown scenarios: what will the EU/US crash look like? AUDIO: CITY OF LONDON MAFIA? Former fraud squad detective Rowan Bosworth-Davies: evidence the UK Banking Commission didn't want to hear - Cyprus & Libor fraud 'Rain Man' Tom Hayes turns queen's evidence - SS/US pact: Nazi Enriched Uranium & Plutonium used on Japan in 1945 US Atom bombs? - Leeds, Cornwall, Scarborough, Kidwelly and Stoke Mandeville ritual abuse rings exposed - Secret preparations for UK 'Arab Spring' second civil war? - Was Jimmy Savile procuring Haut de la Garenne boys for Tory PM Ted Heath who were then murdered? - Bilderberger Ken Clarke got Savile top Broadmoor job - Israeli general's son blasts through the Zionist lies - New Bank of England boss: Mark Carney, Goldman Bilderberger - My Nov12 talk: City of London's Nazi cult - Vile BBC censorship of former ambassador & anti-torture whistleblower Craig Murray - TueNov13: Bilderberg Steering Committee sneak 2012 meeting in Rome - Zio-Nazi complicity: Betrayal of Mossad's Isser Harel, Israeli government lost its soul and moral conscience in 1963 - Jonathan Meades takes apart Nazis, Speer... & Prince Charles - Simon Wiesenthal fake & Isser Harel true Nazi hunter - EU Goebbels-style Iran/Syria censorship prepares way for Middle East war - Nazis Not Defeated, Poisonous Legacy Haunting BritainAnders Breivik, assassin for Templar ZioNazi network? - Hidden History: 1944, A Bridge Not Far! - Nazi continuity finance: Bormann Network inaugurated at Red House Meeting, Strasbourg, Thursday 10th August 1944 - The Nuclear/Beeching Axe/North Sea Oil connection? - HSBC Drug money launderer Lord Green STILL in coalition cabinet! Too Big To Jail: HSBC Financing Terrorism - Princess Diana's assassination approved at W.A.G. on Wed23Jul1997 - Tue26Jun12: Crooked MI5 DG Jonathan Evans endorses G4S Olympic security & hints at false flag blamed on Iran! It started here=> Fri22Jun12: London Olympics undercover: G4S Mafia wide open for terror and false flag attack - British Army waterboarding Catholics in 1972 - Bilderberg's founder a pathological Nazi liar - Why do BBC managers protect dead child abuser Savile? - BBC3 7/7 Hatchet Job exposed - Assange: 1. What Really Happened In Sweden? 2. BBC Newsnight Lies & Distortion - US Bilderberg politicians commit Logan Act felony - 40 min comprehensive roundup of Bilderberg 2012 Toxic Barclays/BBC taboo, with TruNews.com - Does Bilderberg sit on a mountain of Nazi flight capital? - Bilderberg email list subscribe - Marcus Agius: Barclays Chairman, BBC Trustee & Bilderberg crook - Bilderberg 2012: 31May-01Jun, USA - Veterans for Peace UK - Who Owns Britain? Top 1000 Rich List hoarders (the 0.0015%) could pay off entire deficit with £30bn to spare - UK press censorship: Please support Ofcom censored PressTV + Freemason Anders Behring Breivik is uniting Zionism and Nazism - The Mafia inside Scotland Yard - Inaugural 1954 Bilderberg meeting took place at site of Nazi slaughter a decade before - A Bridge Not Far: Bilderberg spawned in Nazis' Oosterbeek Hexenkessel or 'witches cauldron' - Operation Market Garden's three curious Bilderberg connections - Organised crime, City money laundering & London's 2012 Olympics - Read rare book about Hitler's No. 2 whose death was faked in 1972: Martin Bormann, Nazi In Exile by Paul Manning (1981) - Bishop Sean Manchester on diabolism & the modern church - Killing truth for war: British Army Psychological Warfare officers from 15 PsyOps (Chicksands, Beds.) headhunted for 20 x salary by private war crime Strategic Communications firms - Perception managers killing democracy: The Billionaires Tea Party - Le Monde: Goldman Sachs' masonic government - Masonic cult exposed - Killer cop still not named as IPCC pile lies upon lies in unarmed Mark Duggan August riots murder case - loan sharks overturn democracy to appoint Europe's Prime Ministers Costas Lapavitsas on Newsnight - Bilderberg elite inside dealers' Euro paralysis: 'Shock Doctrine' for political takeover - Halloween 2011 PEPIS: Vigilance, The Enemy Within in peacetime and war - audio: The far right and royal witchcraft - Adam Werritty: Mossad agent at heart of MoD? - BBC: banksters orchestrating disaster - Windsor Castle royal paedophile ring - UK & US lost 3 nukes each! - Weapons Grade Plutonium available on Black Market - Banksters looting plus police impunity sets example for UK copycat rioters? - Three Masonic terrorists: phone hacker Jonathan Rees; Dunblane's Thomas Hamilton & Norway's Anders Behring Breivik - S. Yorks. police Intelligence Analyst sacked when told bosses 7/7 London Bombings not carried out by Muslim terrorists Bilderberg 2011: The Good, The Bad, and the Incredibly Wealthy - Handbags at dawn - Lord Mandelson's nature walk - George Osborne attending as chancellor - For he's a jolly good Rockefeller - The shower curtain of shame - Bilderberg Conference 2011 - Swiss govt MP Dominique Baettig demands arrest of Kissinger - Italian MEP Mario Borghezio beaten up - IMF Chief DSK's plan to avert debt crisis torpedoed in New York sting - My Bilderberg 2011 briefing parts 1, 2, 3 & 4 - *Bilderberg 2011 discussions* - guerilla reporters' briefing - Hidden agenda driving us to WWIII [audio]My weekly radio shows & web news - Listen live to: BCfm 5-7pm Fridays & Unity FM 8-10 TuesdaysCameron's critics assassinated? Key witness against Coulson Sean Hoare & constituency chairman Christopher Shale - Andy Hayman & John Yates: Scotland Yard 'Untouchables' phone hacking cover up - Occupy London 9 demands - Euro crisis, orchestrated push for fascist Eurostate? - Interfaith prayers at St Paul's Cathedral 'Sermon on the Steps' - New Scientist & RT: Secret network that runs the world - My Oct11 talk 'UK media taboos exposed' - The Round Table, Secret Government of the British Empire, from The Anglo-American Establishment, by Carrol Quigley - May11: Nazis v. Gadaffi - Bin Laden 'assassinated' (Strategic media-op buries Gadaffi family assassination war crime) following 'wikileak' that Al Qaeda will explode nuke in Europe - David Cameron lost three REAL nukes in 1992 Tory party S.A. nuclear weapons deal - Frank Kitson's Gangs & Counter Gangs textbook for political assassinations - Mar11: Arab world in 'eschatological phase' - Feb11: CIA/XE 'terminator terrorist' Raymond Davis caught laying nuclear 'patsy trail' in Pakistan - Egypt's Gladio: Interior minister Habib Al Adly ordered church bombing - US Nazi Frank Wisner in Egypt - John Loftus: America's Nazi Secret - Jan11: Bilderbergers Balls & Osborne nix UK finance - Murder at Pike River Mine - Oct10: UK Bilderberg announces forced labour policy - Bilderberg 2010: BBC's Marcus Agius conspires with terrorists - 'Richest of the rich & shyest of the shy': pix INSIDE Bilderberg - A manifesto - My Bilderberg email lists (1) & (2) - Goldmine Sachs: Bilderberg bankers' cultMy TV: The Big Story, 7/7 London bombings (2010); EMTV, Criminalisation of UK political structure; Birmingham Central Mosque 7/7 London bombings meeting; BBC2 7/7 Conspiracy Files (2009); UK Press Freedom; Bilderberg, 7/7, 9/11 & Princess Diana assassination; UK media liesMy latest news and arts radio shows, latest forum posts, War Of Terror&Bilderberg bulletin & forum - My Blip, Google & YouTube videos - Ex MI5 officer Annie Machon: MI6 interference in the media - War On Terror Phase II, The Media Battle - 'Swine Flu': BioWarfare? - New to Bilderberg? Prof. Peters' Bilderberg primer - Freemasonry's UK Bilderberg organiser - See me in the London Bombings Enquiry Debate - Private military/MI6 behind MP expenses 'crisis'? - Tucker & Skelton's 2009 Bilderberg reports - Bilderberg 2009 booklet & participant list - Revealed: Shocking OSS report shows Nazis planned Fourth Reich in the EU - Freemason John Robison's Proofs Of A Conspiracy - UK Bilderberg chief Ken Clarke, advocates 'Illuminist' policies - Illuminati in a nutshell - My printable Revelation guide - Ex USMC Iraq Vet. Major calls for Citizen Intelligence Hunter/Raptors - Man-god antichrist, Hitler's New World Order c.1940 - The Bullingdon Club, Nat Rothschild's drug crazed Bully Boys - 7/7 Israeli Army control London Underground security!! - Prince Charles: 'The Antichrist & A Cup Of Tea'...? Rumours abound... but is it Biblical? - Israeli IDF terror Mafia: Montreal the next terror target? - LECTURE: False Flag Fever: Diabolical PMCs & Intel. Agencies self-harming - God's love is no secret, the dangers of 'mysticism' in the Kabbalah - Scandal rocks Israeli owned 7/7 security firm - White Supremacists' mystical nonsense - Bild Zeitung: German NATO troops desecrate human graves in Neo-Nazi 'Totenkopf Skandal' ~~~~ Bypass all these headlines: see the bilderberg.org site map or search this site - complete index to this website ~~~~Wikipedia censors Bilderberg Nazi roots & attendance lists - International Jewish Solidarity Network - Ergenekon: Turks foil Mossad coup plot - All WWIII News headlines - Dennis Wheatley: witchcraft/satanism analysis & Dinner with Aleister Crowley [audio] - Zionists' Gaza War Crimes - Bernard Levin, David Frost: That Was The Week That Was - Bilderberg's Financial Chaos latest - Global financial[pdf] crisis engineered at secret Bilderberg Conferences? - I interview Dr. Naseem from Birmingham Central Mosque about CIA/Mossad/MI6 Pseudo-Muslim terror groups - Spiritual activist's timeline and kingdom toolkit - Avon and Somerset police's corrupt Chief Constable - English Civil War, was Charles I 'the commoners' king'? - 60% of Oil price rises are SPECULATION - Ex-Illuminati member John Todd - Prof. Anthony Sutton on YouTube - BBC: Bilderberg founder Bernhard helped Nazi war criminals to escape Nuremberg trials - This war is evil, Occult whistleblowers detail perverse secret governments? - Hear my hour long talk on Revelation and the War on Terror - messages - US Marine and ex-SAS hero tell WWIII like it is. The former on Venezuelan TV - Holocaust engineers IBM take over Bristol police - 8 Million Muslim Deaths for Western oil, Media Denial of New Holocaust - Thirty years of Bilderberg participant lists surface - Adam Curtis' BBC Documentaries: available - more films here'If our enemies knew what we were trying to do they could have stopped us but they were too stupid' - Adolf HitlerFour great injustices & mainstream media cover-ups1. Eugenicist Prince Philip approved the assassination of Princess Diana - ten years retrospective film2. The 7/7 London bombs were planted by PMCs, MI6 militant atheists & the Israeli Army3. 911 was an Inside Job and Cheney/Brezinski plan further attacks on the West4. Dr. David Kelly was murdered for exposing a war crime conspiracyCorrectly Predicted! The Coming Economic Collapse - YouTube - Martin Summers - Ten Stars! Immortal Technique and Eminem's 911 Conspiracy music vid - Connecting the dots, Neocons and Fascists: Same Difference - Amazing short Illuminati (satanists inside freemasonry) film and great music - Israel's Avigdor Lieberman gets covert "thumbs up" to strike Iran - Money laundering, the Bilderberg Al Qaeda connections - Prince Charles the Druid uses Ouija board to make policy decisions - AUDIO: 9/11 eyewitness Scott Forbes' describes 26hr WTC security breach 2 days before 9/11 - get my monthly PEPIS bulletin - Israeli based London Underground CCTV contractors big time crooks - Opponents of EU are terrorists - Bohemian Grovers gaa-gaa for seventies UK model Hour long Pre Bilderberg 2007 briefing [audio] - hi-band - lo-bandForget the DaVinci Code read Daniel & RevelationSomething is dreadfully wrong in the British Royal family - HRH Prince Charles' admiration for Nazi architect who lied at Nurenberg - Will HRH Prince Charles emerge as the Antichrist? Messianic Jew Tim Cohen thinks so - British Muslims fight back against Ruth Kelly's 'government approved' Islam - Was Aleister Crowley Barbara Bush's father? - 103 Suspected 9/11 Criminal Coconspirators - Watch before YouTube ban WakeyMedia! or PNACattack - Israeli mafia and ex IDF officer with pre London Bombings access to London Underground tunnels - PLEDGEBANK: Can you pledge twenty quid towards my 7/7 investigative documentary? - Paul Hausser's comments about NATO's origins in the SS - Investigating possible political assassinations in the UK - Communique to the Turkish Prime Minister re Bilderberg 2007 - Bush annoys our Queen Liz II with public Illuminati reference? - Adam Curtis' Pandora's Box and Dennis Potter In Person available on DVD - Secret papers of the Illuminati: printable or web page - The Greco Report -
  12. Thought for the century: When the first 'terrorist' nuclear weapon explodes how will anyone know which CIA/MI6/Gladio/Mossad/NATO/BND/mercenary/XE/PMC covert ops. unit planted it......?
  13. USA = global terrorism HQ: Mercenaries MPRI with close connections to the U.S. administration and funding terrorism: The Carlyle Group - Comedian Bill Hicks on the elite: The Global Elite [mp3 audio file] - Magic Mountains of the Mind - The Economist's Elite Conference Guide
  14. Channel 4 'Secret Rulers of the World' Bilderberg Film AvailableThe transatlantic elite misuse the terms 'democracy' and 'freedom': Is fixing the election in Florida democracy? Can the world's press be free when it has to adopt business values to survive?Bilderberg elitists in: 1. NATO 2. Western National Politics 3. The European Commission 4. European Parliament
  15. Jesus was and is the messiah, son of God - Jewish evidence[This site campaigns for a press conference at the start of all Bilderberg meetings - and a declaration from the steering committee that any consensus reached must be in our public, not their private interest]
  16. www.bilderberg.org- Full Indexwww.bilderberg.org - Introductionwww.bilderberg.org - The English Civil War pageswww.bilderberg.org - Search this site using keywordswww.bilderberg.org - Examine/join Bilderberg email listwww.bilderberg.org - Threats to this site and request for help www.bilderberg.org - Guestbook, article postings, discussion and rantspace
  17. My original Site was pulled for nearly six months by Demon Internet
  18. Offline browser downoads - selection 1 http://download.com.com/3150-2377-0.htmlOffline browsers downloads - selection 2http://www.sofotex.com/Download/Browsers/Offline_Browsers/
  19. Teleport - recommended http://www.tenmax.com/
  20. Bilderberg Conferences - Research on this private elite club, started by an ex-Nazi, that sets the agenda for a Corporate controlled Europe - participant lists - my email list archive - roots - common/single market
  21. Other Western Elites - World Economic Forum - Skull and Bones - Bank for International Settlements - Transatlantic Business Dialogue - Sun Valley the media elite - Bohemian Grove - British American Project - Trilateral Commission
  22. The Oil Industry and Destruction of Public Transport - General Motors - Beeching and the railways - the car takes over from the train - greed or coincidence?
  23. Culture, Communication and Control - The Information War is on - UK journalist murdered - Media mind control - Coup at the BBC - CIA - Censorship - Arrests of journalists - Congress for Cultural Freedom - Videos available
  24. Fascism, State Terror and Power Abuse - MI5 and MI6 - 'War on Terrorism' - Kissinger's trial - NATO as the World Army - Human Genetics - Microwaves and Non-Lethal weapons
  25. Quark, Strangeness and Charm - Illuminati Leaks - 666 - Babylonian - Man Made Religion - Sport - Ritual Human Sacrifice - Secret Western Government Apparatus - Bohemian Grove - Freemasons Exposed
  26. Doubletake: Hidden History - The Levellers and The Diggers - Cuban Missile Crisis - H-Bomb tests - Enclosure of Land - The Commoners King
  27. Personal but not private - Close to Home - Outlandish Emails I get - my post being opened - legal threats
  28. There is another way - Bible - Land - Levellers - Tolkien - Tribulation - The Changes - Inclosure of the Land
  29. "...somebody has to take governments' place, and business seems to me to be a logical entity to do it." - David Rockefeller - Newsweek International, Feb 1 1999.
  30. "Fascism should rightly be called corporatism, as it is the merger of state and corporate power" - Benito Mussolini
  31. "...the world is governed by very different personages to what is imagined by those who are not themselves behind the scenes." - Benjamin Disraeli - British PM - 'Coningsby' pub. 1844
  32. "It is discouraging to think how many people are shocked by honesty and how few by deceit" Noel Coward
  33. "The Treaty of Rome, which brought the Common Market into being, was nurtured at Bilderberg meetings." George McGhee, former US Ambassador to West Germany
  34. "I don't think it's true to say that we want to keep it [Bilderberg] out [of the public consciousness], we never wanted to get it in. We don't encourage people to mention it in the mainstream press because we don't encourage idle speculation about what we do. ...... We forbid individual attendees from giving press meetings at our conferences, and we do that not because we're secrecy mad, but because we want to control the politicians who come." Martin Taylor - Secretary General, Bilderberg - interviewed by Jon Ronson for the UK Channel 4 TV programme 'Secret Rulers of the World' transmitted 27Jun01
  35. "There are powers at work in this country about which we have no knowledge'. H. M. Queen Elizabeth II (in conversation with royal butler Paul Burrell) Daily Mirror
  36. Definition of a Power Elite: 'A group of men, similar in interest and outlook, shaping events from invulnerable positions behind the scenes.' C. Wright Mills 'The Power Elite'
  37. "The maintenance of secrets acts like a psychic poison, which alienates their possessor from the community" Carl Jung: 'Modern Man in Search of a Soul'
  38. "In the councils of government, we must guard against the acquisition of unwarranted influence, whether sought or unsought, by the military-industrial complex. The potential for the disastrous rise of misplaced power exists and will persist." President Eisenhower - farewell address to the nation - Jan 16th 1961
  39. "What luck for rulers that men do not think" - Adolf Hitler
  40. "The great masses of the people will more easily fall victims to a big lie than a small one" Adolf Hitler: 'Mein Kampf'
  41. "Their motivation is, that the elite shall be able to act in secrecy. It is not because they are evil, but because they believe in what they are doing. International capital wants to remove all obstacles to globalisation - and all obstacles to the right of capital to act freely without constrictions such as regard for the environment, social responsibility or human rights. Demands from local democracies are such obstacles." Birger Schlaug, Swedish Green party
  42. "Globalisation is the new Totalitarianism" - Vandana Shiva, NEF Peoples' Summit, Birmingham 1998
  43. (link to old site 1) (link to old site 2) - site 2 recently pulled by Demon Internet - see below
  44. This site campaigns for general press access to Bilderberg venues - and a declaration from the organisers that the discussions are public, not private
  45. www.bilderberg.org Guestbook
  46. See also: What are Bilderberg Conferences all about?
  47. It can take a while - please be patient http://www.freetranslation.com
  48. 1. Being pulled by host after spurious 'legal threats' - this has already happened {details on separate page}2. Domain name theft by lawyers - see: http://www.ncchelp.org and the history of the 1990's court case around the previous http://www.iftp.org3. Hacking, trojans and viruses4. Delisting or downlisting by search engines5. Content removal by Google search engine
  49. Use Google anonymously here www.scroogle.org operated by Google critic Daniel Brandt from Google Watch
  50. Examples:
  51. 1. Mirror the site - ie. download the entire site and put it up somewhere else2. Financial support
  52. Copyright notice

H4 Headings

11 :
  1. Whether you want to copy this website so you can mirror it on your site, or whether you just want it all downloaded on to your hard drive, best way is to download one of the 'offline browsing' software packages below. All you do is type in www.bilderberg.org and the software will find and download all the pages. You can then use your software to grab any site you like in its entirity without having to save each page individually.
  2. Mirrored sites within this site:Council on Foreign Relations - Rockefeller's business club runs U.S. foreign policyPartial mirror of disappeared website called TheModernCrusade.orgIn depth analysis of Bilderberg 2000 and related mattersDefinitive Kennedy assassination analysis
  3. The Council on Foreign Relations - mirror of a website all about this private elite club that seems to decide on U.S. foreign policy
  4. The Land and Freedom pages - some important lessons from the people's English Civil War struggles
  5. Tony Gosling, July 2001 contact me
  6. ......or you can try Babelfish at Altavista
  7. Google as a weapon of War - 'Truth is the first casualty of war'
  8. All these three examples have been on the web for at least two years (test conducted 26Nov02)
  9. Licence is granted for non-commercial use in all media, including mirroring of the entire site - except for extracts and quotations which are not authored by me. Licence for commercial use is normally free but only with my - email me - permission.
  10. Moral rights are asserted not to have my material distorted and to be identified as the author of my own articles both by name and through an appropriate hyperlink to http://www.bilderberg.org
  11. The term @nticopyright is to encourage free use of material amongst non-profit publications. It does not mean copyright is waived.

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

3 :

Total Images

86 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

311:
  1. No text
    http://www.bilderberg.org/tonyhom.htm
  2. No text
    http://www.bilderberg.org/phpBB2/
  3. No text
    http://www.bilderberg.org/search/search.htm
  4. No text
    http://www.bilderberg.org/goodlink.htm
  5. No text
    http://www.bilderberg.org/badlink.htm
  6. Will Hutton
    http://www.bilderberg.org/reports.htm
  7. press
    http://www.bilderberg.org/bilder.htm#press
  8. archive
    http://www.bilderberg.org/TonyGoslingTwitterArchive.zip
  9. 1
    http://www.bilderberg.org/TonyGoslingTwitterArchive1.zip
  10. 2
    http://www.bilderberg.org/TonyGoslingTwitterArchive2.zip
  11. 3
    http://www.bilderberg.org/TonyGoslingTwitterArchive3.zip
  12. 4
    http://www.bilderberg.org/TonyGoslingTwitterArchive4.zip
  13. Bilderberg 2019 at Montreux
    https://www.bilderberg.org/phpBB2/viewforum.php?f=35
  14. : Bilderberg
    http://www.bilderberg.org/BankingPirates.pdf
  15. spawned
    http://www.bilderberg.org/phpBB2/viewtopic.php?t=6765
  16. in Nazis' Sep1944 Oosterbeek
    http://www.bilderberg.org/BankingPirates.pdf
  17. - Operation Market Garden's 3
    http://www.bilderberg.org/BankingPirates.pdf
  18. Bilderberg 'coincidences'
    http://bilderberg.org/bildhist.htm#Market
  19. No text
    http://www.bilderberg.org/BankingPirates.pdf
  20. Diana's Secret Tapes About Prince Charles' Scandals & Palace Rape Entrusted To Paul Burrell
    http://bilderberg.org/sis.htm#mahogany
  21. John Morgan's Summary Of The MI6 Assassination Of Princess Diana. Inquest & Police Investigation
    http://bilderberg.org/sis.htm#morgan
  22. No text
    http://bilderberg.org/sis.htm#mahogany
  23. No text
    http://bilderberg.org/sis.htm#spy
  24. Bilderberg paper
    https://www.bilderberg.org/bildhist.htm#The
  25. IS HERE
    http://new.bilderberg.org
  26. 7-10th June, NH Torino Lingotto Congress, Turin, Italy
    https://www.bilderberg.org/phpBB2/viewforum.php?f=34
  27. open docx
    http://bilderberg.org/christchurch.docx
  28. PDF
    http://bilderberg.org/christchurch.pdf
  29. 15Jan2016 eBook - BANKING PIRATES OF THE CITY OF LONDON by John D. Christian
    http://www.bilderberg.org/royal.htm
  30. Word DOC
    http://www.bilderberg.org/BankingPirates.doc
  31. PDF
    http://www.bilderberg.org/BankingPirates.pdf
  32. No text
    https://www.bilderberg.org/phpBB2/viewtopic.php?t=7731
  33. despite Bilderberg traitors
    https://www.bilderberg.org/traitor.htm
  34. My scenarios for two Market Garden wargames
    http://bilderberg.org/courage.htm
  35. Muslims
    http://bilderberg.org/usglobal.htm#first
  36. they came
    http://bilderberg.org/infowar.htm
  37. Martin Bormann & Nazi survival: Allied/Nazi traitors in 'Marilyn, Hitler and Me, The memoirs of Milton Shulman' (1998)
    http://bilderberg.org/shulman.htm
  38. Bilderberg 2017: 1-4 June, Chantilly, Virginia, USA
    https://www.bilderberg.org/phpBB2/viewforum.php?f=33
  39. The Traitor of Arnhem by Lt. Col. Oreste Pinto
    http://www.bilderberg.org/traitor.htm
  40. Hatchet jobs on me
    http://bilderberg.org/legal.htm#Holland
  41. Bilderberg forum news & contextual feed for June 11-14 2015 Bilderberg meeting in Tyrol, Austria
    http://www.bilderberg.org/phpBB2/viewforum.php?f=31
  42. Copenhagen May-June 2014
    http://www.bilderberg.org/phpBB2/viewforum.php?f=30
  43. Bilderberg commissioning terrorist attacks
    http://www.bilderberg.org/phpBB2/viewtopic.php?t=6976
  44. from Bristol Indymedia
    http://bilderberg.org/bimc.htm
  45. Dark forces'
    http://bilderberg.org/endtimes.htm#September
  46. No text
    http://bilderberg.org/trib.htm#timeline
  47. Revelation chronology
    http://www.bilderberg.org/trib.htm#timeline
  48. special
    http://bilderberg.org/pepis08.htm#103
  49. Magic and the Fate of Nations
    http://www.bilderberg.org/skulbone.htm#Magic
  50. the devil 'has surpassed himself'
    http://bilderberg.org/skulbone.htm#surpassed
  51. New World Order
    http://bilderberg.org/skulbone.htm#dennis
  52. Nazi black magic & the anti-christ order
    http://www.bilderberg.org/skulbone.htm
  53. Is freemasonry satanic?
    http://www.bilderberg.org/masons.htm
  54. Geoff Hoon's
    http://bilderberg.org/trib.htm#president
  55. by Abbé Barreul, 1798
    http://bilderberg.org/lucis.htm#code
  56. by Dr John Robison, 1794
    http://bilderberg.org/lucis.htm#johnr
  57. Former Bilderberg Chairman Peter Carrington
    http://www.bilderberg.org/phpBB2/viewtopic.php?t=6416
  58. Green Prince
    http://bilderberg.org/AntichristAndTheGreenPrinceEdn2.doc
  59. John D. Christian
    http://bilderberg.org/royal.htm
  60. enclosure
    http://bilderberg.org/land/tenure#medieval
  61. cause of English Civil War?
    http://bilderberg.org/land/tenure.htm
  62. 1st, 2nd, 3rd degree & Royal Arch masonic initiation rites
    http://bilderberg.org/masons.htm#ritual_texts
  63. No text
    http://www.bilderberg.org/phpBB2/viewtopic.php?p=18546#18546
  64. PDF
    http://www.bilderberg.org/BilderbergParticipantLists1991-2012.pdf
  65. Bilderberg Fringe Festival
    http://www.bilderberg.org/phpBB2/viewtopic.php?t=6989
  66. aged 78
    http://www.bilderberg.org/phpBB2/viewtopic.php?t=6988
  67. Bilderberg 2013: 5-9th June,
    http://www.bilderberg.org/phpBB2/viewtopic.php?t=6981
  68. Rothschildshire, UK?
    http://www.bilderberg.org/phpBB2/viewtopic.php?t=6949&start=15
  69. sacking of BBC DG
    http://bilderberg.org/milne.htm#illness
  70. ritual abuse rings exposed
    http://bilderberg.org/sacrific.htm#Satanism
  71. Nazi continuity finance
    http://bilderberg.org/bildhist.htm#RedHouse
  72. North Sea Oil
    http://bilderberg.org/railways.htm#Have
  73. Tue26Jun12
    http://bilderberg.org/2008.htm#Olympics
  74. pathological Nazi liar
    http://bilderberg.org/bernhard.htm#myths
  75. Logan Act felony
    http://www.bilderberg.org/phpBB2/viewtopic.php?t=6791
  76. Bilderberg 2012:
    http://www.bilderberg.org/phpBB2/viewforum.php?f=28
  77. Zionism
    http://bilderberg.org/nwo2007.htm#Behring
  78. 1954 Bilderberg meeting
    http://bilderberg.org/bildhist.htm#Model
  79. three curious Bilderberg connections
    http://bilderberg.org/bildhist.htm#Market
  80. Martin Bormann, Nazi In Exile
    http://bilderberg.org/bildhist.htm#bormann
  81. Masonic cult
    http://bilderberg.org/masons.htm
  82. The Enemy Within
    http://bilderberg.org/pepis08.htm#vigilance
  83. available on Black Market
    http://bilderberg.org/censored.htm#cook
  84. terrorists
    http://bilderberg.org/masons.htm
  85. Swiss govt MP
    http://bilderberg.org/kissing.htm#07Jun11
  86. 2011
    http://www.bilderberg.org/phpBB2/viewforum.php?f=27
  87. The Anglo-American Establishment,
    http://bilderberg.org/bildhist.htm#rtable
  88. Balls & Osborne
    http://www.bilderberg.org/phpBB2/viewtopic.php?p=15767
  89. Murder at Pike River Mine
    http://bilderberg.org/censored.htm#pike
  90. UK Bilderberg
    http://bilderberg.org/2008.htm
  91. Goldmine Sachs:
    http://bilderberg.org/pepis08.htm#126
  92. Prof. Peters' Bilderberg primer
    http://bilderberg.org/bildhist.htm#The
  93. Freemasonry
    http://bilderberg.org/masons.htm
  94. organiser
    http://www.bilderberg.org/1998.htm#palmer
  95. reports
    http://bilderberg.org/2008.htm#bb09
  96. 2009 booklet & participant list
    http://bilderberg.org/Bilderberg2009.pdf
  97. Revealed
    http://bilderberg.org/pepis08.htm#108
  98. Proofs Of A Conspiracy
    http://bilderberg.org/lucis.htm
  99. nutshell
    http://bilderberg.org/masons.htm#nutshell
  100. Revelation guide
    http://bilderberg.org/rev_wheatley.doc
  101. New World Order c.1940
    http://bilderberg.org/skulbone.htm#Bruce
  102. The Bullingdon Club
    http://bilderberg.org/nwo2007.htm#bullingdon
  103. Rumours abound...
    http://bilderberg.org/endtimes.htm
  104. NATO
    http://www.bilderberg.org/nato.htm
  105. desecrate
    http://www.bilderberg.org/phpBB2/viewtopic.php?t=131
  106. graves in
    http://www.bilderberg.org/skulbone.htm
  107. No text
    http://bilderberg.org/nato.htm
  108. Nazi roots
    http://bilderberg.org/bildlist.htm#from
  109. attendance lists
    http://bilderberg.org/pepis08.htm#105
  110. Turks foil Mossad coup plot
    http://bilderberg.org/nwo2007.htm#turk
  111. witchcraft/satanism analysis
    http://bilderberg.org/apostasy.htm#1974
  112. Financial Chaos
    http://www.bilderberg.org/ordoabchao.jpg
  113. latest
    http://www.bilderberg.org/phpBB2/viewforum.php?f=1
  114. financial[pdf]
    http://bilderberg.org/afp_bb_2008.pdf
  115. timeline
    http://www.bilderberg.org/trib.htm#timeline
  116. kingdom toolkit
    http://bilderberg.org/trib.htm#kingdom
  117. was Charles I 'the commoners' king'
    http://bilderberg.org/land/tenure.htm#ck
  118. are SPECULATION
    http://bilderberg.org/nwo2007.htm#60
  119. Bernhard
    http://bilderberg.org/bernhard.htm
  120. Nazi war criminals
    http://bilderberg.org/pepis08.htm
  121. Revelation
    http://www.bilderberg.org/pepis07.htm#92
  122. messages
    http://www.bilderberg.org/pepis08.htm
  123. Thirty years of
    http://www.bilderberg.org/1991.htm
  124. lists surface
    http://www.bilderberg.org/1991.htm
  125. available
    http://www.bilderberg.org/videos.htm
  126. assassination
    http://www.bilderberg.org/phpBB2/viewforum.php?f=4
  127. retrospective film
    http://www.bilderberg.org/nwo2007.htm
  128. PMCs, MI6 militant atheists & the Israeli Army
    http://www.bilderberg.org/nwo2007.htm#suspicious
  129. Cheney/Brezinski plan
    http://www.bilderberg.org/nwo2007.htm
  130. No text
    http://www.bilderberg.org/nwo2007.htm
  131. Dr. David Kelly
    http://www.bilderberg.org/phpBB2/viewforum.php?f=5
  132. Bilderberg Al Qaeda connections
    http://www.bilderberg.org/pepis07.htm
  133. uses Ouija board to make policy decisions
    http://www.bilderberg.org/phpBB2/viewtopic.php?t=2199
  134. gaa-gaa for seventies UK model
    http://www.bilderberg.org/nwo2007.htm
  135. DaVinci Code
    http://www.bilderberg.org/pepis06.htm
  136. No text
    http://www.bilderberg.org/fall.htm
  137. Daniel & Revelation
    http://www.bilderberg.org/trib.htm
  138. Nazi architect who lied at Nurenberg
    http://www.bilderberg.org/pepis07.htm
  139. Tim Cohen
    http://www.bilderberg.org/royal.htm
  140. Ruth Kelly's 'government approved' Islam
    http://www.bilderberg.org/nwo2007.htm
  141. with pre London Bombings access
    http://www.bilderberg.org/nwo2007.htm
  142. NATO's origins in the SS
    http://www.bilderberg.org/nato.htm
  143. Turkish Prime Minister re Bilderberg 2007
    http://www.bilderberg.org/2007.htm
  144. annoys our Queen Liz II
    http://www.bilderberg.org/nwo2007.htm
  145. Pandora's Box
    http://www.bilderberg.org/videos.htm
  146. Dennis Potter In Person
    http://www.bilderberg.org/videos.htm
  147. printable
    http://www.bilderberg.org/proofs.doc
  148. web page
    http://www.bilderberg.org/lucis.htm
  149. No text
    http://www.bilderberg.org/skulbone.htm
  150. Phoenix on a column
    http://www.bilderberg.org/phpBB2/viewtopic.php?t=596
  151. ! in her own words !
    http://www.bilderberg.org/phpBB2/viewtopic.php?p=932
  152. The European Royals
    http://www.bilderberg.org/trib.htm
  153. anti-christ links page
    http://www.bilderberg.org/royal.htm
  154. Bohemian Grove
    http://www.bilderberg.org/phpBB2/viewtopic.php?t=907
  155. latest bulletin
    http://www.bilderberg.org/pepis07.htm
  156. crooks
    http://www.bilderberg.org/nwo.htm
  157. 'Pussy whipped'
    http://www.bilderberg.org/nwo.htm
  158. The Pilgrims Society
    http://www.bilderberg.org/pepis06.htm
  159. Kissinger
    http://www.bilderberg.org/kissing.htm
  160. Cambridge, UK?
    http://www.bilderberg.org/skulbone.htm
  161. far right/CIA entrapment of innocent people in UK
    http://www.bilderberg.org/nwo.htm
  162. 'liquid explosives' threat is nonsense
    http://www.bilderberg.org/nwo.htm
  163. spiked documentaries available
    http://www.bilderberg.org/videos.htm
  164. CIA inside the CIA:
    http://www.bilderberg.org/cia.htm
  165. banned book by USAF Colonel
    http://www.bilderberg.org/st/index.htm
  166. Public transport knobbled
    http://www.bilderberg.org/railways.htm
  167. Anti-Muslim Psyops
    http://www.bilderberg.org/nwo.htm
  168. and Population Control
    http://www.bilderberg.org/skulbone.htm
  169. NATO/Nazi strategy of tensi
    http://www.bilderberg.org/2004.htm
  170. forty years of rehersals
    http://www.bilderberg.org/2004.htm
  171. definitive Bilderberg paper
    http://www.bilderberg.org/bildhist.htm
  172. Blair's impeachment
    http://www.bilderberg.org/nwo.htm
  173. Terror laws 'Nazi'
    http://www.bilderberg.org/hell.htm
  174. No text
    http://www.bilderberg.org/trib.htm
  175. Nazis
    http://www.bilderberg.org/boneswar.htm
  176. concentration camps
    http://www.bilderberg.org/hell.htm
  177. torture to cook up its lies
    http://www.bilderberg.org/sis.htm
  178. Mercenaries MPRI
    http://www.bilderberg.org/boneswar.htm
  179. The Global Elite
    http://www.bilderberg.org/elite.mp3
  180. The Economist
    http://www.bilderberg.org/wdm.htm
  181. Bilderberg Film Available
    http://www.bilderberg.org/videos.htm
  182. NATO
    http://www.bilderberg.org/bilder.htm
  183. Western National Politics
    http://www.bilderberg.org/bilder.htm
  184. The European Commission
    http://www.bilderberg.org/2000.htm
  185. European Parliament
    http://www.bilderberg.org/2002.htm
  186. Jewish evidence
    http://www.bilderberg.org/trib.htm
  187. www.bilderberg.org - The English Civil War pages
    http://www.bilderberg.org/land/index.htm
  188. www.bilderberg.org - Search this site using keywords
    http://www.bilderberg.org/search/search.htm
  189. www.bilderberg.org - Examine/join Bilderberg email list
    http://www.bilderberg.org/bilder.htm
  190. pulled
    http://www.bilderberg.org/legal.htm
  191. No text
    http://www.bilderberg.org/bernhard.htm
  192. Rockefeller's business club runs U.S. foreign policy
    http://www.bilderberg.org/roundtable/
  193. TheModernCrusade.org
    http://www.bilderberg.org/crusade/index.htm
  194. of Bilderberg 2000 and related matters
    http://www.bilderberg.org/g/
  195. Kennedy assassination analysis
    http://www.bilderberg.org/kennedy/index.htm
  196. No text
    http://www.bilderberg.org/bildhist.htm
  197. 'Secret Rulers of the World'
    http://www.bilderberg.org/bilder.htm
  198. 'The Power Elite'
    http://www.bilderberg.org/bilder.htm
  199. The Bilderberg Group. Basic reference page on arguably the world's most powerful clandestine club
    http://www.bilderberg.org/bilder.htm
  200. Prince Bernhard of The Netherlands - the 'father' of the Bilderberg - his Nazi background and activities surrounding his 1975 resignation over the Lockheed bribery scandal
    http://www.bilderberg.org/bernhard.htm
  201. To what extent are critics of Bilderberg Anti-Jewish conspiracy theorists? Is this just an excuse to divert the attention of the political 'left' away from Bilderberg?
    http://www.bilderberg.org/jewish.htm
  202. History and origins of Bilderberg group and a cheeky bit of work by an investigative reporter - whatever happened to Robert Eringer?
    http://www.bilderberg.org/bildhist.htm
  203. Bilderberg Group conference 2006
    http://www.bilderberg.org/2006.htm
  204. Bilderberg conference 2004
    http://www.bilderberg.org/2004.htm
  205. Bilderberg conference 2003, Versailles, France
    http://www.bilderberg.org/2003.htm
  206. Bilderberg Conferences 2002 and beyond - after the demise of Spotlight how will we know when and where they are taking place?
    http://www.bilderberg.org/2002.htm
  207. Bilderberg 2001 - Gothenburg Sweden - 'Press Release' participant list and a run-down of Bilderberg related coverage in 2001
    http://www.bilderberg.org/2001.htm
  208. Bilderberg 2000 in Brussels, Belgium, participants and other info. on this conference
    http://www.bilderberg.org/2000.htm
  209. Pictures from Bilderberg 2000 Conference in Brussels
    http://www.bilderberg.org/2000pics.htm
  210. 1999 Conference in Portugal - a page of information and articles specific to this conference including official press release and participant list
    http://www.bilderberg.org/1999.htm
  211. Leaked minutes from the 1999 conference in Sintra, Portugal
    http://www.bilderberg.org/1999mins.htm
  212. The 1998 Conference at Turnberry in Scotland, Attendees list, Email discussions etc
    http://www.bilderberg.org/1998.htm
  213. List of people who attended Bilderberg 1997 conference. Here's the official confession. It went out on the Reuters wire service, but with a legal warning to remind editors not to print it.
    http://www.bilderberg.org/1997.htm
  214. Reports and list of people who attended Bilderberg 1996 conference
    http://www.bilderberg.org/bildlist.htm
  215. Bilderberg 1994 conference in Helsinki, Finland - participant list and agenda for the meeting
    http://www.bilderberg.org/1994.htm
  216. Bilderberg conference 1993 down in Athens, Mr Blair's now one of the crew!
    http://www.bilderberg.org/1993.htm
  217. Bilderberg Meeting in 1992, scant details so far - only the agenda
    http://www.bilderberg.org/1992.htm
  218. 1991 Bilderberg Meeting - Gordon Brown, UK chancellor's interview
    http://www.bilderberg.org/1991.htm
  219. Bilderberg reports and papers, background information on the Bilderberg Group
    http://www.bilderberg.org/reports.htm
  220. Canadian state governors jetting around the world to hob-nob with the rich and powerful types. They all find our 'right to know' an irksome annoyance
    http://www.bilderberg.org/cocktail.htm
  221. The Power Elite Public Information Service - otherwise known as my anti-elitists email list - not to be confused with PENIS or PEPSI - no, its PEPIS, and these are the archives
    http://www.bilderberg.org/pepis98.htm
  222. No text
    http://www.bilderberg.org/bilder.htm
  223. The Council on Foreign Relations - mirror of a website all about this private elite club that seems to decide on U.S. foreign policy
    http://www.bilderberg.org/roundtable/index.htm
  224. The Skull and Bones fraternity at Yale University, New Haven, Connecticut where the Bush family - George W. Bush, his father and his grandfather were/are all members, only trouble is it's a death cult based in a mausoleum on the university campus
    http://www.bilderberg.org/skulbone.htm
  225. The Bank for International Settlements - Set up before World War Two and described by Carrol Quigley as 'The apex of the global banking system.' - Respected economists wanted it closed down after WWII for the role it played in financing the Nazis but still it thrives
    http://www.bilderberg.org/bis.htm
  226. The World Economic Forum at Davos - Doesn't get a lot of media coverage but this is quite possibly the biggest meeting of Businessmen in the world with the bosses of the 1000 largest corporations in attendance
    http://www.bilderberg.org/davos.htm
  227. Transatlantic Business Dialogue - The Agenda Setters, material obtained by The Guardian under American freedom of information law and begrudgingly under European freedom of information law - the end of Democracy
    http://www.bilderberg.org/critic.htm
  228. Sun Valley, Idaho - Once a year the world's media get together for a gathering of the most powerful players and financiers of the entertainment industry. Is the media discussing how to provide what its audiences want to see - or is it cow-towing to the money masters?
    http://www.bilderberg.org/sunvally.htm
  229. The British American Project for the Successor generation - little-known elitist grouping - said to have close connections to British Intelligence agencies, the military, politics and the media
    http://www.bilderberg.org/bap.htm
  230. BLACK HUMOUR: Arch-mage David Rockefeller talks frankly about his sterling efforts (along with his élite chums) to save us from ourselves
    http://www.bilderberg.org/rockef.htm
  231. I-MaFia... Unbelievable wedges of formerly public assets privatised by the IMF and financial institutions
    http://www.bilderberg.org/imf.htm
  232. DANGEROUS LIAISONS - A report on the Global Elite cataloging many clandestine clubs and listing names of individuals involved
    http://www.bilderberg.org/wdm.htm
  233. David Rockefeller's mission to the far east, the Trilateral Commission
    http://www.bilderberg.org/trilat.htm
  234. What's good for General Motors is, supposedly, good for America. Now is that The continent and its people or is that the growth of US GNP???
    http://www.bilderberg.org/socal.htm
  235. The tyranny of the car... public transport in the UK has been deliberately run off the rails. Beeching and the tearing up of the tracks
    http://www.bilderberg.org/railways.htm
  236. Ken Livingstone! Back in the early eighties Ken and his deputy at the GLC, Dave Wetzel attempted to rid London of the plague of the motor car, it was not to be.
    http://www.bilderberg.org/farefare.htm
  237. Standard Oil made one family a heap of money, never mind that as a necessity democracy fell by the wayside, just what did Standard get up to?
    http://www.bilderberg.org/whatafel.htm
  238. Public transport in the United States subjected to the selfish arbitrary will of the super-greedy. Everybody looses out so why is it allowed to happen??
    http://www.bilderberg.org/nclchoms.htm
  239. How consumption has been turned into an obsession, it's incredible what we will become used to if nobody comes along to tell us it is rubbish and that we are being used... critique of consumerism
    http://www.bilderberg.org/ncl.htm
  240. The BBC take people to court for not paying their TV licence fee, yet they caved in to political control years ago, public service....? Forget it! The views of an ex-BBC local radio researcher and reporter [ie. me]
    http://www.bilderberg.org/milne.htm
  241. The Congress for Cultural Freedom - The CIA funded takeover of the European Art Scene
    http://www.bilderberg.org/ccf.htm
  242. Information: Freedom of speech is under attack according to some documents published by the US military
    http://www.bilderberg.org/infowar.htm
  243. Policing the News and the murder of Martin O'Hagan - More and more journalists in the UK are being arrested by the police, missing their deadlines, then being released without charge.
    http://www.bilderberg.org/nuj.htm
  244. Product Placement - advertising by stealth - Misguided souls in the marketing industry, armed with endless supplies of cash, are finding great ways of getting into your head. Persuading their products into the hands of your favourite TV star without you knowing.
    http://www.bilderberg.org/product.htm
  245. Drugs, police and Intelligence services. The CIA manipulation of US culture and systematic infringement of civil liberties
    http://www.bilderberg.org/cia.htm
  246. The BBC Charter and agreement - full text in one page here - easy to download and print out - unlike on the BBC site!
    http://www.bilderberg.org/bbchartr.htm
  247. VHS videos available - top quality content which has not yet been released by mainstream distributers
    http://www.bilderberg.org/videos.htm
  248. Great Emperors rule todays massive media empires, D-notices gag the press in the guise of protecting national security... enter Citizen Kane's world of mind control and press power
    http://www.bilderberg.org/censored.htm
  249. Corporate Labour, Britain's public relations team are having trouble convincing us all that they give a damn. Maybe they'd like to?? but the mess is far too big for them to handle
    http://www.bilderberg.org/newlab.htm
  250. No text
    http://www.bilderberg.org/sis.htm
  251. World War III 2005 press archive
    http://www.bilderberg.org/hell.htm
  252. World War III press article third archive - beginning January 2004
    http://www.bilderberg.org/wwiii.htm
  253. World War III second archive - some of the main stories through later 2003
    http://www.bilderberg.org/usglobal.htm
  254. World War III - first archive - The phoney 'war on terrorism' - an excuse to clamp down on civil liberties and ignore responsibility for acts of aggression abroad
    http://www.bilderberg.org/boneswar.htm
  255. MI5 and the Christmas Tree files - secret political vetting at the BBC
    http://www.bilderberg.org/mi5bbc.htm
  256. A secret state within a state: The British Secret Intelligence Services - MI5 and MI6 massive buildings full of uptight, unaccountable paranoiacs - what are they up to?
    http://www.bilderberg.org/sis.htm
  257. Eugenics: Genetic expertise is now being applied to humans. Human Genetics. Haven't we heard talk of a master race before - disabled people rightly taking action
    http://www.bilderberg.org/hgenetix.htm
  258. NATO is the world army which must prevail - the defensive charter is forgotten about
    http://www.bilderberg.org/nato.htm
  259. Microwaves and other non lethal weapons are being developed in a shroud of secrecy
    http://www.bilderberg.org/micwaves.htm
  260. Echelon: Led by the American NSA intelligence agencies are invading the privacy of ordinary people here, there and everywhere without any effective scrutiny. Who are the National Security Agency in the U.S. and what on earth are they up to?
    http://www.bilderberg.org/strigas.htm
  261. The Trial of Henry Kissinger. Who will bring this terrorist suspect to justice????
    http://www.bilderberg.org/kissing.htm
  262. Systematic blacklisting of potential employees for their independent mindedness is still going on so long as you value profits above your staff (and you don't hold your records on computer!)
    http://www.bilderberg.org/caprim.htm
  263. The Illuminati, fact or fiction? In 1798 professor John Robison, professor of natual philosophy and secretary to Edinburgh's Royal Society published correspondance of many of the original members including Adam Weishaupt the Illuminati's Jesuit educated founder.
    http://www.bilderberg.org/lucis.htm
  264. The Freemasons, benevolent, sad or dangerous? What goes on inside the lodge? A selection of critical views are revealed here
    http://www.bilderberg.org/masons.htm
  265. The Apostasy - The gradual fusing of all world religions under a false prophet - a global man-made religion - the dilution of the Judeo/Christian message
    http://www.bilderberg.org/apostasy.htm
  266. One view of the various individual arms of a secret western government - pulling the strings behind the scenes??
    http://www.bilderberg.org/secret.htm
  267. What is the social function of sport? Turning us all into spectators? Training in blind obedience? Links and some analysis
    http://www.bilderberg.org/sport.htm
  268. Human Sacrifice was commonplace in pre-Christian times. Even here in the UK amongst the Druids
    http://www.bilderberg.org/sacrific.htm
  269. The Shengen Agreement and the number 666 on barcodes - Translation of a pamphlet from a Greek monastery
    http://www.bilderberg.org/shengen.htm
  270. The Bohemian Grove - a private club and rollicking zone for the rich and powerful in the United States that has been going for over a hundred years
    http://www.bilderberg.org/bohos.htm
  271. "Babylon shall fall..." Whatever Babylon may be a metaphor for in the modern age ancient Babylon, in modern-day Iraq, was pretty damn sordid
    http://www.bilderberg.org/babylon.htm
  272. The Land and Freedom pages - some important lessons from the people's English Civil War struggles
    http://www.bilderberg.org/land/index.htm
  273. King Charles I - he banned enclosure taking the side of ordinary people against the landowners - there is fascinating evidence that he was 'The Commoners' King'
    http://www.bilderberg.org/tenure.htm
  274. The Cuban missile crisis, insane hydrogen bomb tests, some amazing facts and pics from a world on the brink
    http://www.bilderberg.org/hbomb.htm
  275. Power elite watchers like me are bound to get some amazing emails! Here are some of them with names concealed where necessary
    http://www.bilderberg.org/emails.htm
  276. This website is under threat from several sources - this page explains what some of those threats are and how you can help make sure it stays out there
    http://www.bilderberg.org/legal.htm
  277. Surveillance is getting out of control what with the UK Home secretary, who signs surveillance directives being blind we should be worried and suspicious
    http://www.bilderberg.org/violate.htm
  278. My articles
    http://www.bilderberg.org/violate.htm
  279. that were deleted from Bristol Indymedia
    http://bilderberg.org/bimc.htm
  280. The book of Daniel to Revelation - Jesus stepping in at the last minute to obliterate the forces of darkness and their followers and banish sin and evil from the world
    http://www.bilderberg.org/trib.htm
  281. The End Times texts - Brian Redhead gives his view of the Book of Revelation - stuff about the End Times - commentaries by various people - my personal selection
    http://www.bilderberg.org/endtimes.htm
  282. The Shoplifting Vicar - one of the UK's best writers who hardly gets a hearing
    http://www.bilderberg.org/vicar.htm
  283. Monetary Reform - How about we stop central banks from legally printing counterfeit money? Banks should not be able to monopolise money nor create it out of nowhere
    http://www.bilderberg.org/monref.htm
  284. The sixties and seventies UK television emporium - some pictures of my favourite programmes from the golden age of television
    http://www.bilderberg.org/tvpics.htm
  285. Life skills, or mind control? Setting our own curriculum. What education do we want for our kids? A page about Home Education.
    http://www.bilderberg.org/homedn.htm
  286. Hippy and dippy - followers of New Age alternative remedies leave themselves open to ridicule - much to my amusement!
    http://www.bilderberg.org/yoghurt.htm
  287. The Lord of the Rings, short extract, some great writing - allegory with modern Fascism and written with a knowledge of the occult and - it seems - the Biblical apocrypha
    http://www.bilderberg.org/rohan.htm
  288. In 1975 a series swept across our TV screens here in the UK that was to leave an indelible impression upon me and many like-minded kids - The Changes
    http://www.bilderberg.org/changes.htm
  289. Consequences, or strange tales, an example of a game where someone writes a few lines on a piece of paper, then folds it over so there is only a line showing and the next person carries on the story.
    http://www.bilderberg.org/conseq.htm
  290. David Rockefeller on parade - satire
    http://www.bilderberg.org/rockef.htm
  291. Tribulation page
    http://www.bilderberg.org/trib.htm
  292. The Bilderberg Group and the project of European unification - From Lobster magazine No. 32
    http://www.bilderberg.org/bildhist.htm
  293. downloadable as a Rich Text Document.
    http://www.bilderberg.org/bblob.rtf
  294. the PEPIS list
    http://www.bilderberg.org/bilder.htm
  295. contact me
    http://www.bilderberg.org/tonyhom.htm
  296. What are Bilderberg Conferences all about?
    http://www.bilderberg.org/bilder.htm
  297. Being pulled by host after spurious 'legal threats' - this has already happened {details on separate page}
    http://www.bilderberg.org/legal.htm
  298. Labournet
    http://www.bilderberg.org/http;/www.labournet.org
  299. Here is my full email correspondence with David Krane, Google's Director of Corporate Communications
    http://www.bilderberg.org/legal.htm
  300. BBC Charter page
    http://www.bilderberg.org/bbchartr.htm
  301. censored Greg Dyke junket article
    http://www.bilderberg.org/milne.htm
  302. my section on Google's clandestine love-affair with the U.S. Department of Defense
    http://www.bilderberg.org/legal.htm
  303. The Changes
    http://www.bilderberg.org/changes.htm
  304. email me
    http://www.bilderberg.org/tonyhom.htm
  305. NSA/Department of Defense & Google software engineer Matthew Cutts
    http://www.bilderberg.org/legal.htm
  306. http://www.bilderberg.org/2000.htm
    http://www.bilderberg.org/2000.htm#daily
  307. http://www.bilderberg.org/sis.htm
    http://www.bilderberg.org/sis.htm#mosques
  308. http://www.bilderberg.org/index.htm
    http://www.bilderberg.org/index.htm#intro
  309. here
    http://www.bilderberg.org/videos.htm
  310. http://www.bilderberg.org
    http://www.bilderberg.org/
  311. Tony's homepage
    http://www.bilderberg.org/tonyhom.htm

Links - Internal (nofollow)

0:

Links - Outbound

530:
  1. is here
    http://www.bilderbergmeetings.org/
  2. site
    https://37.220.108.147/members/www.bilderberg.org/
  3. forum
    https://37.220.108.147/members/www.bilderberg.org/phpBB2/
  4. Bristol MP
    http://eis.bris.ac.uk/~plcdib/burke.html
  5. Press TV
    https://www.youtube.com/user/videosptv/search?query=tony+gosling
  6. N
    http://www.911forum.org.uk/board/search.php?search_author=TonyGosling
  7. ews
    http://www.911forum.org.uk/board/search.php?search_author=TonyGosling
  8. R
    http://www.radio4all.net/index.php/contributor/2149
  9. adio
    http://www.radio4all.net/index.php/contributor/2149
  10. shows (1)
    http://www.thisweek.org.uk/
  11. (2)
    http://www.dialectradio.co.uk
  12. YouTube
    https://www.youtube.com/channel/UCMn9GM4atN3t7AHJBbHMR0Q
  13. c
    http://www.youtube.com/user/PublicEnquiry
  14. hannels
    http://www.youtube.com/user/PublicEnquiry
  15. Twitter
    http://www.twitter.com/tonygosling
  16. 9/11
    https://groups.google.com/forum/#!forum/uk-911-truth
  17. land rights
    http://groups.yahoo.com/group/diggers350/
  18. Bilderberg
    http://groups.yahoo.com/group/pepis/
  19. column
    http://rt.com/op-edge/authors/tony-gosling/
  20. The War isn't Meant to be Won (2017)
    http://www.radio4all.net/index.php/program/95800
  21. When Propaganda Stops Working (2016)
    https://www.youtube.com/watch?v=ruTB_s0IOZk
  22. News or Theatre? (2015)
    https://www.youtube.com/watch?v=xitt9ps_ts8
  23. Revolutionary Acts of Journalism (2014)
    https://www.youtube.com/watch?v=VNz2AZ6mQvY
  24. TALK in Oosterbeek, 22 Sep 2018
    https://www.youtube.com/watch?v=OPgrQsbVbI0
  25. A Bridge Not Far
    http://www.radio4all.net/index.php/program/58485
  26. Hexenkessel
    http://groups.yahoo.com/group/PEPIS/message/323
  27. Charles Will Become Head Of State In April 2021 But Queen Elizabeth Won't 'Abdicate' 
    https://www.express.co.uk/news/royal/1210550/prince-charles-title-queen-step-down-18-months-retire-prince-regent-royal-family-latest
  28. Brexit news
    http://www.911forum.org.uk/board/viewtopic.php?t=22930&start=240
  29. ex-Bilderberg bigwig Ken Clarke MP ejected from Conservative party
    https://www.nottinghampost.com/news/nottingham-news/live-ken-clarke-tory-brexit-3282056
  30. secret deal with Hitler's treasurer Bormann
    https://politicsthisweek.wordpress.com/martin-bormann-and-the-nazi-gold/
  31. -> The timeline
    https://politicsthisweek.wordpress.com/martin-bormann-and-the-nazi-gold/
  32. No text
    https://politicsthisweek.wordpress.com/martin-bormann-and-the-nazi-gold/
  33. No text
    https://libcom.org/library/here-now-1617
  34. Here and Now magazine
    https://libcom.org/library/here-now-magazine
  35. Prof. Mike Peters who wrote for it
    https://libcom.org/library/here-now-magazine
  36. Davos 2018
    https://www.mirror.co.uk/news/politics/davos-man-diehard-enemy-fairer-11891128
  37. explainer (Daily Mirror)
    https://www.mirror.co.uk/news/politics/davos-man-diehard-enemy-fairer-11891128
  38. 22May2019 eBook - CHRISTCHURCH MASSACRE:
    https://off-guardian.org/2019/03/27/lone-wolf-myth-covers-up-possible-mossad-role-in-new-zealand-terrorist-attack/
  39. AND JOHN PODESTA by John D. Philman
    https://leozagami.com/2019/03/16/what-was-john-podesta-doing-in-new-zealand-until-the-day-before-the-mosque-shootings/
  40. FIRST
    http://www.dailymail.co.uk/news/article-1031697/We-Muslims-new-Jews-says-MP-victim-hit-run-firebomb-attack.html
  41. they
    http://www.911forum.org.uk/board/viewtopic.php?t=11670
  42. came
    http://news.bbc.co.uk/2/hi/uk_news/england/west_midlands/4723731.stm
  43. for
    http://www.unobserver.com/layout4.php?id=2707&blz=1
  44. the
    http://www.abc.net.au/worldtoday/content/2004/s1071909.htm
  45. for the
    http://english.aljazeera.net/programmes/general/2008/06/2008619125018644639.html
  46. unembedded
    http://www.rsf.org/special_iraq_en.php3
  47. journalists
    http://www.independent.co.uk/news/world/middle-east/mod-tactics-are-putting-unembedded-journalists-lives-at-risk-592947.html
  48. they came
    http://www.channel4.com/news/catch-up/display/playlistref/210811/clipid/210811_dalefarm
  49. 4 the
    http://groups.yahoo.com/group/Diggers350/message/3631
  50. travellers
    http://www.mwaw.net/2009/04/19/bowen/
  51. top
    http://www.antiwar.com/
  52. news
    http://www.globalresearch.ca/
  53. sites
    http://www.whatreallyhappened.com/
  54. RT
    https://www.youtube.com/user/videosptv/search?query=tony+gosling
  55. Nukes
    http://www.youtube.com/watch?v=8Q1EN5_9nIk
  56. History
    http://www.youtube.com/watch?v=aAmqiXoLsoA
  57. recorded in Dresden 1
    https://www.youtube.com/watch?v=WFqAmOiCzJM
  58. 2
    https://www.youtube.com/watch?v=9AhoYp8MOJA
  59. 3
    https://www.youtube.com/watch?v=ZVFbNJOxilo
  60. 4
    https://www.youtube.com/watch?v=qHz1ay6gG-c
  61. 5
    https://www.youtube.com/watch?v=KaMEwbQCJxg
  62. 6
    https://www.youtube.com/watch?v=Pka6P6JE3nk
  63. & masterclass
    https://secure.gn.apc.org/members/www.bilderberg.org/phpBB2/viewtopic.php?t=7481
  64. and dissected the 2005, 7/7 London Bombings
    http://www.washingtonsblog.com/2015/10/77-led-to-wars-abroad-and-loss-of-freedoms-at-home-but-do-we-know-what-really-happened-that-day.html
  65. eschatology presentation
    https://www.youtube.com/watch?v=fn471P7-U4I
  66. Oosterbeek WWII slaughter first Bilderberg meeting site
    https://www.rt.com/op-edge/184228-battle-arnhem-anniversary-commemoration/
  67. Churchill's Bomb by Graham Farmelo
    https://www.youtube.com/watch?v=sHfLZHT1SW0
  68. BBC won't tell you about BREXIT
    https://www.youtube.com/watch?v=oAq1q1_swyM
  69. No text
    http://www.telegraph.co.uk/news/worldnews/europe/1356047/Euro-federalists-financed-by-US-spy-chiefs.html
  70. No text
    http://spitfirelist.com/books/martin-bormann-nazi-in-exile/
  71. Daily Beast
    http://www.thedailybeast.com/articles/2015/07/08/russia-today-has-an-illuminati-correspondent-really.html
  72. Washington Post
    http://www.washingtonpost.com/posteverything/wp/2015/07/09/confessions-of-an-american-illuminati/
  73. Bilderberg 2015 'Kiss of death' for neutral Austria?
    http://www.youtube.com/watch?v=qs9U672pBjs
  74. Charlie Hebdo
    http://aanirfan.blogspot.co.uk/2015/01/mossad-attacks-paris.html
  75. NATO false flag terrorism and the historical picture
    http://21stcenturywire.com/2015/01/11/episode-67-sunday-wire-cest-masterplan-de-paris-terror-with-guests-tony-gosling-and-basil-valentine/
  76. .mp3
    http://traffic.libsyn.com/sundaywire/acr_sunday_wire_ep_67.mp3
  77. on Ukraine: military chiefs, arms bosses and billionaire speculators ... Charlie Skelton's Bilderblog
    http://www.theguardian.com/world/series/charlie-skelton-bilderblog
  78. Bilderberg 2013 talk
    http://www.youtube.com/watch?v=/19BTXVDnuhI
  79. Malaysian MH370
    http://www.911forum.org.uk/board/viewtopic.php?p=167021#167021
  80. Top Italian judge publishes
    http://www.youtube.com/watch?v=kYmLiRCMJmA
  81. No text
    https://www.redressonline.com/2016/11/did-canadian-taxpayers-foot-islamic-states-recruitment-bill/
  82. No text
    https://youtu.be/pSfFuVZY1W4
  83. Neo-Nazi coup
    http://www.counterpunch.org/2014/02/27/the-neo-nazis-of-ukraine/
  84. caught in tug-of-war
    http://www.globalresearch.ca/ukraine-protests-carefully-orchestrated-the-role-of-canvas-us-financed-color-revolution-training-group/5369906
  85. NATO & Russia
    http://www.globalresearch.ca/the-road-to-moscow-goes-through-kiev-how-the-protests-in-ukraine-transformed-into-a-coup-that-could-target-russia/5370479
  86. GCHQ use Orwell's 'Telescreens'
    http://www.youtube.com/watch?v=T7FgyzdetDs
  87. Death & Masonic Corruption
    http://www.youtube.com/watch?v=0VGHcA4O3Rk
  88. (full coverage)
    http://www.911forum.org.uk/board/viewtopic.php?p=166083#166083
  89. The Garrison Interview (1988)
    http://www.youtube.com/watch?v=UGhUniEYR3Y
  90. JFK sacrificed to priesthood of the 'old gods'
    http://www.youtube.com/watch?v=x_A4fBSroiE
  91. WWF, Bilderberg
    http://biostate.blogspot.co.uk/2012/06/how-bioregional-state-can-save-pandas.html
  92. The Silence Of The Pandas
    http://www.dailymotion.com/video/x105tsl_wwf-silence-of-the-pandas_news
  93. Julie Beal: Digital ID For All UK Citizens starting with the poor
    http://www.youtube.com/watch?v=gG6SdOQJg8M
  94. declares war on press, defends NSA GCHQ criminal data trawls
    http://www.youtube.com/watch?v=TIaBweBmqE8
  95. Killing journalism
    http://www.youtube.com/watch?v=NzUcRbkjsJk
  96. psychological warfare services
    http://www.guardian.co.uk/business/2005/sep/11/theobserver.observerbusiness4
  97. US investigative journalist Michael Hastings
    http://www.youtube.com/watch?v=aYl6gZ8zRpo
  98. CIA Director Paul Brennan's DOMESTIC
    http://reason.com/blog/2013/08/13/michael-hastings-was-investigating-john
  99. when his 'smart' Mercedes 'crashed', killing him
    http://www.911forum.org.uk/board/viewtopic.php?p=165791#165791
  100. Hitler's deputy Martin Bormann's 1953 born daughter:
    http://www.youtube.com/watch?v=re_RXyWoIG0
  101. Manning
    http://www.spitfirelist.com/books/martin-bormann-nazi-in-exile/
  102. Op JB
    http://www.amazon.co.uk/Op-JB-Christopher-Creighton/dp/0671855654
  103. Mark Carney's REAL pro-Nazi employer
    http://www.youtube.com/watch?v=2aKyHoZQg6Y
  104. Churchill, Morton, Fleming, George VI, Mountbatten's
    http://www.911forum.org.uk/board/viewtopic.php?p=164999#164999
  105. Roger Cook:
    http://www.indymedia.org.uk/en/2012/09/500459.html
  106. killed The Cook Report's
    http://www.radio4all.net/index.php/program/63107
  107. Does Iran
    http://www.911forum.org.uk/board/viewtopic.php?p=162351#162351
  108. ex SS20 Thermonuclear Warheads?
    http://www.radio4all.net/index.php/program/62725
  109. power network
    http://groups.yahoo.com/group/PEPIS/message/399
  110. No text
    http://www.bookfinder.com/search/?author=Stephen+Sizer&title=Christian+Zionism:+Road-map+to+Armageddon?&lang=en&st=xl&ac=qr
  111. timeline for the future?
    http://www.radio4all.net/index.php/program/62911
  112. Christ's protection
    http://www.davidcannistraci.org/covered.html
  113. secret prison
    http://www.guardian.co.uk/world/2012/feb/07/iraq-death-secret-detention-camp?INTCMP=SRCH
  114. Bloody Sunday massacre?
    http://www.telegraph.co.uk/news/uknews/1416633/Bloody-Sunday-plot-denied-by-Carrington.html
  115. Turkey prosecutes
    http://www.todayszaman.com/tz-web/news-205169-100-ergenekon-suspects-rely-on-intimidation-tactics.html
  116. Mossad coup plotters
    http://www.bianet.org/english/kategori/english/111806/yet-another-wave-of-ergenekon-prosecution-37-detained
  117. NATO's Secret Armies (2009)
    http://www.indybay.org/newsitems/2010/07/09/18653266.php
  118. BBC Timewatch (1993)
    http://www.google.co.uk/search?q=operation+gladio+frankovich+ganser
  119. understanding
    http://www.amazon.co.uk/NATOs-Secret-Armies-Operation-Contemporary/dp/0714685003
  120. NATO/Nazi
    http://video.google.com/videoplay?docid=3409375633223151728
  121. threat to our world
    http://www.veoh.com/browse/videos/category/educational_and_howto/watch/v99656573TspA79S
  122. Allan Francovich:
    http://www.911forum.org.uk/board/viewtopic.php?t=17946
  123. Rotary Club version of the Gestapo'
    http://www.youtube.com/watch?v=YRKgTmxcMaw
  124. No text
    http://www.radio4all.net/index.php/program/104716
  125. child porn images under cover of 'Bilderberg leak'
    http://www.youtube.com/watch?v=zislzpkpvZc
  126. Launch a massive cover-up
    http://www.911forum.org.uk/board/viewtopic.php?p=165009#165009
  127. the guise of 'National Security'
    http://www.guardian.co.uk/world/2013/jun/17/defence-d-bbc-media-censor-surveillance-security
  128. Logan Act crimes & breaches of UK Parliamentary Code
    http://www.911forum.org.uk/board/viewtopic.php?p=164688#164688
  129. Bilderberg politicians
    http://groups.yahoo.com/group/PEPIS/message/471
  130. Sat 8th & Sun 9th June 2013
    http://bilderberg2013.co.uk/
  131. Banging Up The Banksters
    http://www.youtube.com/watch?v=g2oWZ6Z3Pks
  132. investigative journalist
    http://groups.yahoo.com/group/PEPIS/message/461
  133. Jim Tucker [video]
    http://www.youtube.com/watch?v=Q2p_8KKB7e0
  134. Boston marathon bombing
    http://www.bollyn.com/#article_14053
  135. killed/maimed by FBI?
    http://imgur.com/a/Nx8EU
  136. PR team rushes in to aid FBI
    http://www.911forum.org.uk/board/viewtopic.php?p=164489#164489
  137. Poll Tax
    http://books.google.co.uk/books?id=eBq4j1AKBwUC&pg=PA503&lpg=PA503&dq=Victor+Rothschild+Margaret+Thatcher&source=bl&ots=F8qvSy7hEE&sig=zAuxX-x-V62L4-j2WQ37iPfAi7o&hl=en&sa=X&ei=sztsUYODN8SjO_H9gMgC&ved=0CDIQ6AEwCA
  138. MI5/MI6
    http://aangirfan.blogspot.co.uk/2010/12/assanges-wikileaks-peter-wrights.html
  139. what will the EU/US crash
    http://www.radio4all.net/index.php/program/67362
  140. Former fraud squad detective
    http://www.radio4all.net/index.php/program/67362
  141. evidence the UK Banking Commission didn't want to hear
    http://www.opednews.com/articles/How-The-British-Banking-In-by-Mick-Meaney-130401-869.html
  142. Tom Hayes turns queen's evidence
    http://www.radio4all.net/index.php/program/67196
  143. SS/US
    http://www.911forum.org.uk/board/viewtopic.php?p=163907#163907
  144. Nazi Enriched Uranium
    http://www.youtube.com/watch?v=Ruq7GVd9k6w
  145. Plutonium
    http://www.bibliotecapleyades.net/ciencia/atomicbomb/contents.htm
  146. 1945 US Atom bombs
    http://www.911forum.org.uk/board/viewtopic.php?t=21774
  147. Leeds
    http://radio4all.net/index.php/program/63107
  148. Cornwall
    http://www.911forum.org.uk/board/viewtopic.php?p=163463#163463
  149. Scarborough
    http://www.express.co.uk/posts/view/354855/Jimmy-Savile-ruled-paedophile-ring
  150. Kidwelly
    http://www.bbc.co.uk/news/uk-wales-south-west-wales-12677043
  151. Stoke
    http://www.express.co.uk/posts/view/370439/Jimmy-Savile-was-part-of-satanic-ring
  152. Mandeville
    http://www.911forum.org.uk/board/viewtopic.php?p=163465#163465
  153. UK 'Arab Spring' second civil war
    http://www.youtube.com/watch?v=s8cj9bR9tYQ
  154. Jimmy Savile procuring Haut de la Garenne boys for Tory PM
    http://www.indybay.org/newsitems/2013/01/12/18730007.php
  155. who were then murdered?
    http://www.radio4all.net/index.php/program/63107
  156. Ken Clarke got Savile top Broadmoor job
    http://www.911forum.org.uk/board/viewtopic.php?p=163465#163465
  157. blasts through the Zionist lies
    http://www.youtube.com/watch?v=TOaxAckFCuQ
  158. Bank of England boss:
    https://secure.gn.apc.org/members/www.bilderberg.org/phpBB2/viewtopic.php?p=18149#18149
  159. Goldman Bilderberger
    http://www.forbes.com/sites/eamonnfingleton/2012/11/27/the-bilderberg-group-strikes-again-or-why-do-the-british-keep-drinking-the-globalist-kool-aid/
  160. City of London's Nazi cult
    http://www.youtube.com/watch?v=-K1l9cg6bM8
  161. BBC censorship
    http://www.radio4all.net/index.php/program/64555
  162. former
    http://www.craigmurray.org.uk/archives/2011/10/gould-and-fox-werritty-schemed-for-attack-on-iran/
  163. ambassador
    http://www.theinsider.org/news/article.asp?id=652
  164. anti-torture whistleblower
    http://inquiringminds.cc/uk-911-truth-bbc-systematic-censorship-of-former-ambassador-craig-murray-tony-g
  165. Craig Murray
    http://www.craigmurray.org.uk/
  166. Bilderberg Steering Committee
    http://www.911forum.org.uk/board/viewtopic.php?p=163075
  167. sneak 2012
    http://groups.yahoo.com/group/PEPIS/message/415
  168. meeting in Rome
    http://beforeitsnews.com/economy/2012/11/event-notice-bilderberg-steering-committee-meeting-tuesday-in-rome-2462652.html
  169. Zio-Nazi complicity
    http://www.fpp.co.uk/BoD/Mossad/Isser_Harel.html
  170. Isser Harel
    http://www.amazon.co.uk/dp/0553025015
  171. lost its soul and moral conscience in 1963
    http://www.911forum.org.uk/board/viewtopic.php?p=161342#161342
  172. takes apart Nazis, Speer... & Prince Charles
    http://www.youtube.com/watch?v=sTfbBvIEbfA
  173. Isser Harel true
    http://www.911forum.org.uk/board/viewtopic.php?p=161393#161393
  174. prepares way for Middle East war
    http://www.youtube.com/watch?v=VCISdmOjGhI
  175. Nazis Not Defeated
    http://spitfirelist.com/books/martin-bormann-nazi-in-exile/
  176. Poisonous Legacy Haunting Britain
    http://www.youtube.com/watch?v=kprZtnQOb_8
  177. Anders
    http://www.indymedia.org.uk/en/2012/09/500751.html
  178. Breivik
    http://911forum.org.uk/board/viewtopic.php?p=162428#162428
  179. assassin
    http://www.activistpost.com/2012/04/anders-behring-breivik-islam-and-israel.html
  180. Templar
    http://www.telegraph.co.uk/news/uknews/terrorism-in-the-uk/9212090/Anders-Behring-Breivik-trial-the-real-Lionheart.html
  181. ZioNazi
    http://www.911truth.no/2012/04/breivik-uniting-zionism-and-nazism/
  182. network?
    http://edlreview.blogspot.co.uk/2012/08/breivik-manifesto-review-pamela-geller.html
  183. 1944, A Bridge Not Far!
    http://www.radio4all.net/index.php/program/58485
  184. Red House Meeting
    http://911forum.org.uk/board/viewtopic.php?p=161974#161974
  185. Nuclear
    http://911forum.org.uk/board/viewtopic.php?p=162431#162431%23161788
  186. Beeching Axe
    http://911forum.org.uk/board/viewtopic.php?p=161788#161788
  187. Drug money launderer Lord Green
    http://www.newsdaily.com/stories/bre86n18d-us-hsbc-green/
  188. Too Big
    http://groups.google.com/group/uk-911-truth/browse_thread/thread/bfdeed40f98cb261
  189. To Jail
    http://www.911forum.org.uk/board/viewtopic.php?p=161957#161957
  190. Financing Terrorism
    http://www.guardian.co.uk/world/2012/jul/21/drug-cartels-banks-hsbc-money-laundering
  191. Princess Diana's assassination
    http://www.bookfinder.com/search/?author=John+Morgan&title=Paris-London+Connection%3A+The+Assassination+of+Princess+Diana&lang=en&st=xl&ac=qr
  192. on Wed23Jul1997
    http://www.911forum.org.uk/board/viewtopic.php?p=161058#161058
  193. Jonathan Evans endorses G4S Olympic security
    http://www.channel4.com/news/london-2012-not-an-easy-target-says-mi5-boss
  194. hints at false flag blamed on Iran
    http://bcfm.org.uk/2012/06/29/17/friday-drivetime-77/18961
  195. here=>
    http://www.youtube.com/watch?v=Si7DEkeWsOs
  196. London Olympics
    http://www.911forum.org.uk/board/viewtopic.php?t=21361
  197. G4S Mafia wide open
    http://bcfm.org.uk/2012/06/22/17/friday-drivetime-76/18658
  198. terror
    http://radio4all.net/index.php/program/60932
  199. false flag
    http://www.indymedia.org.uk/en/2012/06/497362.html
  200. waterboarding Catholics
    http://www.911forum.org.uk/board/viewtopic.php?t=21362
  201. Bilderberg
    http://www.youtube.com/watch?v=tviCaODZ0zQ
  202. founder
    http://vorige.nrc.nl/international/article2500347.ece/Queens_father_a_creature_of_his_own_myths
  203. protect dead child abuser Savile?
    http://www.911forum.org.uk/board/viewtopic.php?t=21591
  204. 7/7 Hatchet Job exposed
    http://youtu.be/YxrQdZSP6FU
  205. What Really Happened In Sweden
    http://www.abc.net.au/4corners/stories/2012/07/19/3549280.htm
  206. Lies & Distortion
    http://www.youtube.com/watch?v=ifBeuZUiJsk
  207. US Bilderberg politicians
    http://rt.com/usa/news/bilderberg-conference-us-members-788/
  208. comprehensive roundup
    http://www.radio4all.net/index.php/program/60581
  209. Toxic
    http://groups.google.com/group/pepis/browse_thread/thread/4bdd9bbdb2a38198
  210. Barclays/BBC taboo
    http://www.standard.co.uk/news/londoners-diary/all-rosy-in-the-garden-again-for-pm-and-nt-7820523.html
  211. TruNews.com
    http://www.trunews.com/Audio/6_04_12_monday_trunews2.mp3
  212. Bilderberg
    http://www.guardian.co.uk/world/series/charlie-skelton-bilderblog
  213. sit on
    http://www.indymedia.org.uk/en/2012/06/496636.html
  214. mountain of
    http://www.radio4all.net/index.php/program/60469
  215. Nazi flight capital?
    http://bcfm.org.uk/2012/06/01/17/friday-drivetime-73/17938
  216. email list
    http://groups.yahoo.com/group/PEPIS/
  217. BBC Trustee
    http://www.sourcewatch.org/index.php?title=Marcus_Agius
  218. Bilderberg crook
    http://www.guardian.co.uk/world/2011/jun/16/bilderberg-2011-tipping-point
  219. Veterans for Peace UK
    http://veteransforpeace.org.uk/
  220. Who
    http://www.radio4all.net/index.php/program/60273
  221. Britain
    http://www.radio4all.net/index.php/program/61276
  222. Rich List hoarders (the 0.0015%)
    http://911forum.org.uk/board/viewtopic.php?p=161040#161040
  223. with £30bn to spare
    http://www.michaelmeacher.info/weblog/2012/04/britains-1000-richest-persons-made-gains-of-155bn-in-last-3-years/
  224. support
    http://www.youtube.com/user/PressTVGlobalNews
  225. PressTV
    http://www.presstv.ir/
  226. Anders Behring Breivik
    http://www.911truth.no/2012/04/breivik-uniting-zionism-and-nazism/
  227. Nazism
    http://www.911truth.no/2012/04/breivik-uniting-zionism-and-nazism/
  228. The Mafia
    http://www.telegraph.co.uk/news/uknews/law-and-order/9174680/Crime-bosses-using-rogue-investigators-to-access-police-files.html
  229. Scotland Yard
    http://www.guardian.co.uk/uk/2012/mar/30/priviate-investigators-police-intelligence-files?newsfeed=true
  230. a decade before
    http://bcfm.org.uk/2012/03/16/17/friday-drivetime-62/15420
  231. witches cauldron
    http://groups.google.com/group/pepis/browse_thread/thread/a5c75e4760cba030
  232. London's 2012 Olympics
    http://www.youtube.com/watch?v=ckUhO1K_pwU
  233. rare book
    http://groups.yahoo.com/group/PEPIS/message/327
  234. Hitler's No. 2
    http://spitfirelist.com/books/martin-bormann-nazi-in-exile/
  235. Paul Manning
    http://911forum.org.uk/board/viewtopic.php?p=160554#160554
  236. Bishop Sean Manchester
    http://www.radio4all.net/index.php/program/57004
  237. diabolism & the modern church
    http://www.radio4all.net/index.php/program/57692
  238. British Army Psychological Warfare officers
    http://bcfm.org.uk/2012/01/13/17/friday-drivetime-54/13525
  239. 15 PsyOps (Chicksands, Beds.)
    http://www.radio4all.net/index.php/program/57021
  240. 20 x salary
    http://911forum.org.uk/board/viewtopic.php?p=159775&highlight=#159775
  241. war crime Strategic Communications firms
    http://bcfm.org.uk/2012/01/20/17/friday-drivetime-55/13733
  242. Perception managers
    http://stratcomevent.com/agenda-miami-2012.php
  243. The Billionaires Tea Party
    http://groups.yahoo.com/group/Diggers350/message/3928
  244. masonic government
    http://www.youtube.com/watch?v=cpNlnpn0Jvk
  245. IPCC pile lies upon lies
    http://911forum.org.uk/board/viewtopic.php?p=159334#159334
  246. August riots murder case
    http://members5.boardhost.com/medialens/msg/1321741459.html
  247. Costas Lapavitsas
    http://www.guardian.co.uk/profile/costaslapavitsas
  248. Newsnight
    http://www.bbc.co.uk/iplayer/episode/b0176k9k/Newsnight_09_11_2011/
  249. Shock Doctrine
    http://www.youtube.com/watch?v=aSF0e6oO_tw
  250. for political takeover
    http://www.nytimes.com/2011/11/07/world/europe/in-greece-economic-crisis-brings-rage-and-paralysis.html
  251. far right and royal witchcraft
    http://www.radio4all.net/index.php/program/55350
  252. Mossad agent
    http://www.911forum.org.uk/board/viewtopic.php?t=20955
  253. banksters
    http://www.bbc.co.uk/news/business-15059135
  254. orchestrating
    http://www.youtube.com/watch?v=QNq9MOc5CBY
  255. disaster
    http://www.bbc.co.uk/programmes/b015f44x
  256. royal paedophile ring
    http://www.911forum.org.uk/board/viewtopic.php?t=20751
  257. UK
    http://www.paltelegraph.com/columnists/peter-eyre/4487-the-us-and-uk-lost-three-nuclear-weapons-each-part-1
  258. US
    http://petereyrepatch.blogspot.com/2010/03/us-and-uk-lost-three-nuclear-weapons_03.html
  259. 3 nukes
    http://www.paltelegraph.com/columnists/peter-eyre/4576-the-us-and-uk-lost-three-nuclear-weapons-each-part-3
  260. each!
    http://petereyrepatch.blogspot.com/2010/03/us-and-uk-lost-three-nuclear-weapons_05.html
  261. police
    http://www.guardian.co.uk/commentisfree/2011/aug/08/context-london-riots
  262. impunity
    http://www.guardian.co.uk/uk/undercover-with-paul-lewis-and-rob-evans/2011/oct/21/second-undercover-officer-accused-misleading-court
  263. example
    http://www.911forum.org.uk/board/viewtopic.php?p=157585#157585
  264. UK copycat rioters
    http://www.youtube.com/watch?v=YDNDrTWrZV0
  265. Three
    http://www.nickdavies.net/category/freemasons/
  266. Masonic
    http://www.freemasonrywatch.org/jahbulon.html
  267. Jonathan Rees
    http://www.guardian.co.uk/media/2011/jun/08/phone-hacking-scandal-jonathan-rees
  268. Thomas Hamilton
    http://www.911forum.org.uk/board/viewtopic.php?p=157334#157334
  269. &
    http://www.terrorism-illuminati.com/
  270. Anders Behring Breivik
    http://www.911forum.org.uk/board/viewtopic.php?t=20646
  271. S. Yorks. police
    http://bcfm.org.uk/2011/07/08/17/friday-drivetime-26/6636
  272. sacked
    http://911forum.org.uk/board/viewtopic.php?t=20614
  273. 7/7 London Bombings not carried out by Muslim terrorists
    http://www.radio4all.net/index.php/program/53018
  274. Bilderberg 2011
    http://www.guardian.co.uk/world/series/bilderberg-2011-swiss-family-rockefeller
  275. and the Incredibly Wealthy
    http://www.guardian.co.uk/world/gallery/2011/jun/15/bilderberg-in-pictures
  276. Handbags at dawn
    http://www.guardian.co.uk/world/blog/2011/jun/13/bilderberg-2011-switzerland
  277. nature walk
    http://www.guardian.co.uk/news/blog/2011/jun/12/bilderberg-2011-mandelson-nature-walk
  278. attending as chancellor
    http://www.guardian.co.uk/world/blog/2011/jun/10/bilderberg-2011-charlie-skelton
  279. Rockefeller
    http://www.guardian.co.uk/world/2011/jun/10/bilderberg-2011-charlie-skelton
  280. of shame
    http://www.guardian.co.uk/world/blog/2011/jun/09/bilderberg-2011-curtains-drawn
  281. Bilderberg Conference
    http://groups.google.com/group/pepis
  282. arrest of Kissinger
    http://dprogram.net/2011/06/12/interview-with-swiss-politician-dominique-baettig-who-confronted-bilderberg/
  283. Mario Borghezio
    http://www.prisonplanet.com/italian-mep-bloodied-sneaking-into-bilderberg-hotel.html
  284. beaten up
    http://www.thelocal.ch/310
  285. IMF Chief
    http://www.independent.ie/opinion/analysis/so-was-dsk-caught-up-in-a-political-sting-2811868.html
  286. DSK's
    http://www.youtube.com/watch?v=eMMkxyYQdjU
  287. avert debt crisis
    http://www.911forum.org.uk/board/viewtopic.php?t=20493
  288. sting
    http://www.marketoracle.co.uk/Article28147.html
  289. Bilderberg 2011
    https://groups.google.com/group/pepis/browse_thread/thread/61d43b0849fc56cd?hl=en
  290. parts 1
    http://www.youtube.com/watch?v=Ua4T8BReSxs
  291. 2
    http://www.youtube.com/watch?v=DzISuNNCJDw
  292. 3
    http://www.youtube.com/watch?v=8JbcoWvdRrA
  293. & 4
    http://www.youtube.com/watch?v=8gPUalhjnIY
  294. briefing
    http://www.americanfreepress.net/html/bilderberg_itinerary_265.html
  295. Hidden
    http://english.ruvr.ru/2011/04/06/48554514.html
  296. driving us to WWIII
    http://english.ruvr.ru/radio_broadcast/25298789/48552316.html
  297. audio
    http://tinyurl.com/3vfufpb
  298. weekly radio
    http://www.thisweek.org.uk/
  299. shows
    http://www.radio4all.net/index.php/series/State+Of+The+City+reports
  300. web news
    http://www.911forum.org.uk/board/search.php?search_author=TonyGosling
  301. BCfm
    http://www.bcfm.org.uk/
  302. 5-7pm
    http://www.bcfm.co.uk/wp-content/themes/bcfm/player.php
  303. Fridays
    http://icecast.commedia.org.uk:8000/commbrist.mp3
  304. Unity FM
    http://radio4all.net/index.php/series/Unity+FM+Birmingham
  305. 8-10
    http://live.canstream.co.uk:8000/unity.mp3.m3u
  306. Tuesdays
    http://live.canstream.co.uk:8000/unity.mp3
  307. Sean Hoare
    http://www.911forum.org.uk/board/viewtopic.php?t=20637
  308. Christopher Shale
    http://www.veteranstoday.com/2011/07/01/murder-glastonbury-and-the-nuclear-nightmare/
  309. Scotland Yard 'Untouchables'
    http://www.youtube.com/watch?v=TGyLbkmsc6E
  310. cover up
    http://www.amazon.co.uk/Untouchables-Dirty-Justice-Racism-Scotland/dp/1903813042
  311. 9 demands
    http://groups.yahoo.com/group/Diggers350/message/3779
  312. fascist Eurostate
    http://www.911forum.org.uk/board/viewtopic.php?p=158932&highlight=#158932
  313. 'Sermon on the Steps'
    http://www.indcatholicnews.com/news.php?viewStory=19206
  314. Secret network that runs the world
    http://groups.google.com/group/pepis/browse_thread/thread/10913b204f1143ac
  315. 'UK media taboos exposed'
    http://www.youtube.com/watch?v=SjIx3WMvHSw
  316. Nazis
    http://www.indymedia.org.uk/en/2011/05/479738.html
  317. Gadaffi
    http://www.youtube.com/watch?v=ucg78FPF1O4
  318. Bin Laden 'assassinated'
    http://www.youtube.com/watch?v=eMMkxyYQdjU
  319. 'wikileak'
    http://www.911forum.org.uk/board/viewtopic.php?p=155412#155412
  320. Al Qaeda will explode nuke
    http://thecomingcrisis.blogspot.com/2011/05/wikileaks-capturing-osama-bin-laden.html
  321. David Cameron
    http://www.paltelegraph.com/columnists/peter-eyre/4576-the-us-and-uk-lost-three-nuclear-weapons-each-part-3
  322. 1992 Tory party S.A. nuclear weapons deal
    http://petereyrepatch.blogspot.com/2010/03/us-and-uk-lost-three-nuclear-weapons_05.html
  323. Gangs & Counter Gangs
    http://www.bilderberg-mirror.org.uk/countergangs.pdf
  324. for political assassinations
    http://www.mail-archive.com/[email protected]/msg117994.html
  325. Arab world
    http://www.globalvision2000.com/
  326. 'eschatological phase'
    http://radio4all.net/index.php/program/50237
  327. CIA/XE 'terminator terrorist'
    http://story.malaysiasun.com/index.php/ct/9/cid/303b19022816233b/id/43354773/ht/Davis-case-is-Pakistan?s-wake-up-call/
  328. caught laying nuclear 'patsy trail'
    http://911forum.org.uk/board/viewtopic.php?t=20323
  329. Interior minister Habib Al Adly
    http://reason.com/blog/2011/02/14/was-the-mubarak-complicit-in-e
  330. church bombing
    http://weeklyintercept.blogspot.com/2011/02/new-years-eve-church-bombing-in-egypt.html
  331. US Nazi
    https://groups.google.com/group/pepis/browse_thread/thread/b71cfee85996bb06
  332. in Egypt
    http://www.antifascistencyclopedia.com/allposts/frank-wisner-son-of-nazi-recruiting-cia-official-sent-to-prod-mubarak
  333. America's
    http://www.talklinecommunications.com/
  334. Nazi Secret
    http://www.amazon.co.uk/Americas-Nazi-Secret-Conspiracy-Theories/dp/1936296047
  335. forced labour
    http://groups.google.com/group/pepis/browse_thread/thread/b2814d3b81a96023
  336. BBC's Marcus Agius conspires
    http://www.guardian.co.uk/world/2010/jun/05/bilderberg-2010-charlie-skelton
  337. terrorists
    http://www.youtube.com/watch?v=LPIBWB9ZKEI
  338. 'Richest of the rich & shyest of the shy':
    http://www.guardian.co.uk/world/2010/jun/05/bilderberg-2010-charlie-skelton
  339. INSIDE
    http://s773.photobucket.com/albums/yy16/frankfurtatlien/WHO is WHO at the SECRET Bilderberg Meeting 2010/
  340. A manifesto
    http://www.public-interest.co.uk/badaca/
  341. email lists (1)
    http://groups.google.co.uk/group/pepis
  342. & (2)
    http://groups.yahoo.com/group/PEPIS/message/177
  343. bankers' cult
    http://www.google.com/url?sa=D&q=http://www.rollingstone.com/politics/news/the-great-american-bubble-machine-20100405
  344. 7/7 London bombings (2010)
    http://www.youtube.com/watch?v=R4sgUkENK9M
  345. Criminalisation of UK political structure
    http://www.blip.tv/file/3327699
  346. 7/7 London bombings meeting
    http://blip.tv/file/2333267/
  347. 7/7 Conspiracy Files (2009)
    http://www.911forum.org.uk/board/viewtopic.php?t=17444
  348. UK Press Freedom
    http://video.google.com/videoplay?docid=4597594757094937470
  349. Bilderberg, 7/7, 9/11 & Princess Diana assassination
    http://video.google.com/videoplay?docid=-7322615325076852499
  350. UK media lies
    http://tonygosling.blip.tv/file/2202180/
  351. news
    http://www.thisweek.org.uk/
  352. arts
    http://www.dialectradio.co.uk/
  353. forum posts
    http://www.911forum.org.uk/board/search.php?search_author=TonyGosling
  354. War Of Terror
    http://groups.google.com/group/uk-911-truth
  355. Bilderberg bulletin
    http://groups.google.com/group/pepis
  356. forum
    http://www.911forum.org.uk/
  357. Blip
    http://tonygosling.blip.tv/
  358. Google
    http://public-interest.co.uk/my_videos/index.htm
  359. YouTube
    http://www.youtube.com/user/PublicEnquiry
  360. MI6 interference
    http://blip.tv/file/2223151
  361. Phase II, The Media Battle
    http://blip.tv/file/2202180
  362. 'Swine Flu':
    http://www.911forum.org.uk/board/viewtopic.php?t=17165
  363. BioWarfare?
    http://themoderatevoice.com/30648/is-swine-flu-the-latest-us-bioweapon-attack-la-cronica-de-hoy-mexico/
  364. Bombings Enquiry Debate
    http://www.youtube.com/watch?v=TBO6dWCtu8w
  365. behind MP expenses 'crisis'?
    http://www.911forum.org.uk/board/viewtopic.php?t=17318
  366. Tucker
    http://www.americanfreepress.net/html/bilderberg_2009_179.html
  367. Skelton
    http://www.guardian.co.uk/world/series/charlie-skeltons-bilderberg-files
  368. Nazis planned Fourth Reich in the EU
    http://www.dailymail.co.uk/news/article-1179902/Revealed-The-secret-report-shows-Nazis-planned-Fourth-Reich--EU.html
  369. Freemason John Robison
    http://www.sacred-texts.com/sro/pc/index.htm
  370. advocates 'Illuminist' policies
    http://www.911forum.org.uk/board/viewtopic.php?p=132354#132354
  371. Citizen Intelligence Hunter/Raptors
    http://www.youtube.com/watch?v=fQlw-o9LYTE
  372. drug crazed Bully Boys
    http://www.911forum.org.uk/board/viewtopic.php?t=16009
  373. Israeli Army control London Underground security!!
    http://www.911forum.org.uk/board/viewtopic.php?t=7998
  374. Prince Charles
    http://www.youtube.com/watch?v=ptufoMx7EKE
  375. The Antichrist
    http://www.documentaries.ws/1/e107_plugins/content/content.php?content.294
  376. A Cup Of Tea
    http://www.youtube.com/view_play_list?p=B227ABCF747309AB
  377. is it Biblical
    http://www.prophecyhouse.com/
  378. Montreal the next terror target?
    http://video.google.ca/videoplay?docid=-8058792061677340917
  379. False Flag Fever
    https://publish.indymedia.org.uk/en/2008/07/403661.html
  380. Diabolical PMCs & Intel. Agencies
    http://video.google.com/videoplay?docid=6640448501056709386
  381. harming
    http://www.911forum.org.uk/board/viewtopic.php?t=15261
  382. the Kabbalah
    http://shalach.org/TorahYoga/YogaWarning.htm
  383. Scandal rocks
    http://www.nineeleven.co.uk/board/viewtopic.php?t=5003
  384. security firm
    http://www.indymedia.org.uk/en/regions/london/2006/10/354202.html
  385. mystical nonsense
    http://www.truthout.org/docs_2006/101906J.shtml
  386. 'Totenkopf Skandal'
    http://www.google.com/news?hl=de&ned=de&ie=ISO-8859-1&q=totenkopf+skandal&btnG=News-Suche
  387. Jewish Solidarity Network
    http://video.google.com/videoplay?docid=2676028300410605968
  388. WWIII News headlines
    http://www.911forum.org.uk/board/viewforum.php?f=4
  389. Dennis Wheatley
    http://www.denniswheatley.info/
  390. Dinner
    http://www.911forum.org.uk/board/viewtopic.php?p=132168#132168
  391. Aleister Crowley [audio]
    http://www.bilderberg-mirror.org.uk/wheatley.mp3
  392. Zionists' Gaza
    http://www.911forum.org.uk/board/viewtopic.php?t=16472
  393. War
    http://groups.yahoo.com/group/palestinianchristians
  394. Crimes
    http://www.palestinecampaign.org/
  395. That Was The Week That Was
    http://video.google.co.uk/videoplay?docid=8702984119494273719
  396. engineered
    http://www.scribd.com/doc/3809830/Bilderberg-2008-Report1
  397. secret
    http://www.americanfreepress.net/html/bilderberg_list_2008.html
  398. Bilderberg Conferences?
    http://www.americanfreepress.net/html/bilderberg_resource_page.html
  399. Dr. Naseem from Birmingham Central Mosque
    http://video.google.com/videoplay?docid=4611793721717698535
  400. Pseudo-Muslim
    http://www.911forum.org.uk/board/viewtopic.php?t=15820
  401. corrupt Chief Constable
    http://bristol.indymedia.org/article/688736
  402. Ex-Illuminati
    http://www.kt70.com/~jamesjpn/articles/john_todd_and_the_illuminati.htm#toddaudio
  403. John
    http://www.youtube.com/watch?v=DerUFYMExS8
  404. Todd
    http://www.youtube.com/watch?v=N9FOuCHSvAE
  405. Anthony Sutton
    http://video.google.com/videoplay?docid=6244851259954264539
  406. YouTube
    http://www.youtube.com/watch?v=KRzPOL9wGBk
  407. escape Nuremberg trials
    http://groups.google.com/group/pepis/
  408. Occult whistleblowers
    http://video.google.com/videoplay?docid=1411186859823657735
  409. perverse secret governments?
    http://video.google.com/videoplay?docid=7672003660947890622
  410. talk
    http://www.nineeleven.co.uk/board/viewtopic.php?p=109908#109908
  411. the War on Terror
    http://www.nineeleven.co.uk/board/viewtopic.php?p=109908#109908
  412. US Marine
    http://www.nineeleven.co.uk/board/viewtopic.php?t=13428
  413. ex-SAS hero
    http://youtube.com/watch?v=cb50-ouA-IA
  414. WWIII
    http://www.youtube.com/watch?v=l7W_nGl9Z2I
  415. like it is.
    http://www.youtube.com/watch?v=4hLTJ6uUL3U
  416. Venezuelan TV
    http://youtube.com/watch?v=cCRTgs5Cqlc
  417. Holocaust engineers IBM take over
    http://bristol.indymedia.org/newswire.php?story_id=27317
  418. Media Denial
    http://www.nineeleven.co.uk/board/viewtopic.php?t=11670
  419. New Holocaust
    http://www.nineeleven.co.uk/board/viewtopic.php?t=11670
  420. more films here
    http://best.online.docus.googlepages.com/
  421. Eugenicist Prince Philip
    http://video.google.com/videoplay?docid=-8263501370427267909
  422. Princess Diana
    http://www.dailymail.co.uk/pages/live/articles/news/news.html?in_article_id=503489&in_page_id=1770
  423. 7/7 London bombs
    http://www.nineeleven.co.uk/board/viewforum.php?f=9
  424. 911 was an Inside Job
    http://www.911blogger.com/
  425. attacks on the West
    http://www.nineeleven.co.uk/board/viewtopic.php?t=11031
  426. war crime conspiracy
    http://www.christusrex.org/www1/news/war-crimes-index-4.html
  427. Correctly Predicted!
    http://www.youtube.com/watch?v=GLnryKeQ16A
  428. YouTube - Martin Summers
    http://www.youtube.com/watch?v=GLnryKeQ16A
  429. 911 Conspiracy music vid
    http://www.youtube.com/watch?v=tD5WlQ54Sg0
  430. Neocons and Fascists: Same Difference
    http://www.nineeleven.co.uk/board/viewtopic.php?t=10880
  431. Illuminati (satanists inside freemasonry) film
    http://www.youtube.com/watch?v=9LEljS3ib84
  432. covert "thumbs up" to strike Iran
    http://www.nineeleven.co.uk/board/viewtopic.php?t=10322
  433. 9/11 eyewitness Scott Forbes' describes 26hr WTC security breach 2 days before 9/11
    http://www.radio4all.net/proginfo.php?id=23942
  434. monthly PEPIS bulletin
    http://groups.google.co.uk/group/pepis?hl=en
  435. CCTV contractors
    http://www.londonbombs.org.uk/
  436. are terrorists
    http://www.nineeleven.co.uk/board/viewtopic.php?t=9761
  437. hi-band
    http://www.radio4all.net/proginfo.php?id=23104
  438. lo-band
    http://www.radio4all.net/proginfo.php?id=23103
  439. Forget the
    http://www.truthout.org/docs_2006/101906J.shtml
  440. Aleister Crowley
    http://www.the7thfire.com/new_world_order/Freemasonry/aliester_crowley_33_degree_Mason_knew_about_human_sacrifice.htm
  441. Bush's
    http://www.google.com/search?q="Barbara+Bush"+"Aleister+Crowley"
  442. father?
    http://www.google.com/search?q="Barbara+Bush"+"Aliester+Crowley"
  443. 103
    http://www.nineeleven.co.uk/board/viewtopic.php?t=11343
  444. 9/11 Criminal
    http://www.whodidit.org/cocon.html
  445. Watch
    http://www.youtube.com/user/Wakeymedia
  446. WakeyMedia!
    http://www.youtube.com/user/Wakeymedia
  447. PNACattack
    http://www.youtube.com/profile?user=wwwPNACATTACKcom
  448. London Underground tunnels
    http://www.nineeleven.co.uk/board/viewtopic.php?t=7998
  449. 7/7 investigative documentary?
    http://www.pledgebank.com/77enquiry
  450. possible political assassinations
    http://www.elementary.org.uk/
  451. public Illuminati reference?
    http://www.nineeleven.co.uk/board/viewtopic.php?t=8869
  452. Greco Report
    http://www.grecoreport.com/archive.htm
  453. ...
    http://www.thisislondon.co.uk/news/article-23382210-details/Charles%2Bputs%2Bhis%2B(carbon)%2Bfoot%2Bin%2Bit/article.do
  454. royal arch 'synagogue of satan?'
    http://bristol.indymedia.org/newswire.php?story_id=25574Array&sc=1
  455. Death of David Kelly
    http://video.google.co.uk/videoplay?docid=-1236026913411489909
  456. here
    http://www.nineeleven.co.uk/board/viewtopic.php?t=6529
  457. Prisoner
    http://www.geocities.com/prisonerno3
  458. Three
    http://prisonerno3.blogspot.com/
  459. Listen to
    http://www.nineeleven.co.uk/board/viewtopic.php?t=5986
  460. William Rodriguez
    http://www.911keymaster.com/
  461. frightfully boring blog
    http://bildt.blogspot.com/
  462. exposes NATO black ops.
    http://www.nineeleven.co.uk/board/viewtopic.php?p=40963
  463. British Army
    http://www.arrse.co.uk/cpgn2/Forums/viewtopic/p=869694.html
  464. RAF
    http://www.pprune.org/forums/forumdisplay.php?f=57
  465. using UK, US and Isreal
    http://suitcaseman.gnn.tv/blogs/11182/Tarpley_Says_Rogue_Network_Behind_911
  466. Diana murder witness Tomlinson
    http://tomlinsonvmi6.blogspot.com/
  467. mirror
    http://richardtomlinson.6x.to/
  468. V for Vendetta edit [watch]
    http://informationclearinghouse.info/article14615.htm
  469. Children of Men
    http://video.google.com/videoplay?docid=7881563546997983623
  470. !hidden!
    http://www.indymedia.org.uk/en/2006/07/344076.html
  471. your Arabic language friends
    http://safy.jeeran.com/buildberg/buildberg.html
  472. Scottish
    http://www.public-interest.co.uk/masons/
  473. spreadsheet
    http://www.bilderberg-mirror.org.uk/scottishfreemasonofficers.xls
  474. Freemasonry
    http://video.google.com/videoplay?docid=-3923632392892449905
  475. Nicholas
    http://www.declarepeace.org.uk/
  476. Langman
    http://cryptome.org/br-gr-spies.htm
  477. WarOnDemocracy
    http://thewarondemocracy.com/
  478. Documentally
    http://documentally.blogspot.com/
  479. Nottingham
    http://urn1350.net/live/listen.php
  480. Bristol
    http://radiodialect.net/
  481. hand in glove
    http://tinyurl.com/bqjdc
  482. Haroon
    http://www.theasiannews.co.uk/news/s/204/204612_britain__recruited_terrorists_meacher_claims.html
  483. Aswat
    http://www.newcriminologist.co.uk/news.asp?id=-1677497717
  484. Mohammed
    http://www.timesonline.co.uk/article/0,,22989-1843471,00.html
  485. Siddique
    http://www.muslimnews.co.uk/paper/index.php?article=2148
  486. Khan
    http://www.asianage.com/main.asp?layout=2&cat1=3&cat2=32&newsid=189032&RF=DefaultMain
  487. 'terror evidence'
    http://www.craigmurray.co.uk/archives/2005/08/one_of_them_mad.html
  488. Suicide Bomber
    http://www.suicidebomber.org.uk/
  489. wanted
    http://www.madden-finucane.com/madden-finucane/case_index/miscellaneous/licence_to_murder.htm
  490. caught
    http://www.opednews.com/articles/opedne_mike_whi_050920_who_s_blowing_up_ira.htm
  491. car
    http://news.xinhuanet.com/english/2005-09/19/content_3514065.htm
  492. explosives
    http://www.globalresearch.ca/index.php?context=viewArticle&code=20050920&articleId=973
  493. crushing
    http://www.globalresearch.ca/index.php?context=viewArticle&code=KEE20050925&articleId=994
  494. censorship
    http://www.flamesong.com/imuk/
  495. real
    http://www.indymedia.org.uk/en/viewallposts.html
  496. censored
    http://uk.indymedia.org/
  497. censored articles
    http://www.indymedia.org.uk/en/2005/03/307658.html
  498. 1
    http://archives.lists.indymedia.org/imc-uk-process/2004-June/001981.html
  499. 2
    http://lists.indymedia.org/pipermail/imc-uk-process/2005-April/date.html
  500. No text
    http://www.jewsnotzionists.org/
  501. funding terrorism: The Carlyle Group
    http://www.thecarlylegroup.com/
  502. No text
    http://www.anybrowser.org/campaign/
  503. www.bilderberg.org - Guestbook, article postings, discussion and rantspace
    http://212.134.74.34/bilderberg/main.asp
  504. Offline browser downoads - selection 1
    http://download.com.com/3150-2377-0.html
  505. Offline browsers downloads - selection 2
    http://www.sofotex.com/download/Browsers/Offline_Browsers/index.html
  506. Teleport - recommended
    http://www.tenmax.com/teleport/pro/home.htm
  507. http://conspiracies.we-h8-u.com/
    http://conspiracies.we-h8-u.com/
  508. http://www.bilderberg-mirror.org.uk
    http://www.bilderberg-mirror.org.uk/
  509. http://www.mega.nu:8080/conspiracy/www.bilderberg.org/
    http://www.my-brighton.co.uk/bilderberg/www.bilderberg.org/
  510. http://www.unclenicks.net/bilderberg/www.bilderberg.org/
    http://www.unclenicks.net/bilderberg/www.bilderberg.org/
  511. http://www.college-radio.org/bilderberg
    http://www.college-radio.org/bilderberg
  512. http://copy_bilderberg.tripod.com
    http://www.apfn.org/bilderberg.org/index.htm
  513. http://bilderberg.redirectme.net/
    http://bilderberg.redirectme.net/
  514. http://bilderberg.pinc.gr
    http://bilderberg.pinc.gr/
  515. Daily Mirror
    http://www.mirror.co.uk/news/burrell/
  516. No text
    http://www.conspiracyarchive.com/NWO/project_paperclip.htm
  517. (link to old site 1)
    http://www.geocities.com/CapitolHill/Congress/7727/
  518. (link to old site 2)
    http://www.tlio.demon.co.uk/
  519. C Wright Mills'
    http://www.cwrightmills.org/
  520. www.bilderberg.org Guestbook
    http://www.gn.apc.org/www.bilderberg.org/guest/guestbook.htm
  521. http://www.freetranslation.com
    http://www.freetranslation.com/
  522. Altavista
    http://www.altavista.com/
  523. http://www.ncchelp.org
    http://www.ncchelp.org/
  524. http://www.iftp.org
    http://web.archive.org/web/20010330203729/http://iftp.org/
  525. Google
    http://www.google.com/
  526. search engine
    http://www.searchenginewatch.com/
  527. Google Watch
    http://www.google-watch.org/
  528. http://www.vegan.swinternet.co.uk/truthcampaign.html
    http://www.vegan.swinternet.co.uk/truthcampaign.html
  529. www.scroogle.org
    http://www.scroogle.org/
  530. No text
    http://www.topsitelists.com/topsites.cgi?user=conspire&area=bestsites

Links - Outbound (nofollow)

0:

Keyword Cloud for Bilderberg.org

11upclosedpagemuchnatonaziablebelowcommitteemi6stateopen77 london bombingsmilitarybritish armyslaverysoinformationpowerbirminghamenginespapermurderedonlybeingdparticipant listseeampcommonerspepisemail listskull and bonestooviewfreemasonryoriginsmonthsfatherlegal20becomesavileprivateeuhappened18economicenglish civil5justcouncil on foreigntwosoftwarehegoingmasonicgreencensorshipmainstreamvariousbush10thpersonalwholeunited statesdennis wheatleyhearbutnecessityactcharlestransatlanticarmybeenoilnewknowledgeblackhasmanymossad10mindmurderkenfaroperationservicesfinancial23persondavid rockefellerhitlersnbsp13removednextaltavistagoogle search enginemeltdownabusebilderbergorgwesternamazinghaveif youtruepolicyunitednuclearofficercommissionmeetinginterviewhisarchivelondon undergroundwatchifpublic transportwheatleycrimestruthliesundergroundiibankthemcariranparticipantbiblical22nowhereenglish civil waryoubormannownfalse flagskullfalseprince charlestakefounderforeign relationsbilderbergers8lordbilderbergdreuropeanwithouthistory4wantedbelievebombingfutureemail15world warcitygeneraltopserviceusaagainstpoliceoosterbeekdefensenewstraitorschiefradio showsdocumentaryworldsclarkeshows2 3expdflistspowerfulaftercapitalconferencesjobsincetheyunderjohn1 2 3junehitlerknownwedoexplosivesinside9antichristsuchdownbulletinuk presspoliticalmirrorscotland yardmecompanyhas beenindexsameflagbackfamilymy bilderberghourarticleindustrybristolrichrulersknowfewitalianrevelationcallsbeforetvsearch engines24princepostresearchuseweaponspower elitedoespoliticianspages2mind controlfactcaneliteplantedcodeenclosuregooglesendbreivikpresscounciletcoldyourtherethroughlondonbridge not faryardserverwarjonathanstartbecausesearchcaughtinternationaldisappearedsurveillanceoveriiinot12askedmi5rightsmarketbestmayalhackingcivil waramstate terrorgoogle searchhumanwhybonesbosseswar iiiarmsbilderberg groupfreemasonsgroveculturenoticeevidencenot faragenciestalkusexposedarnhemtakingassassinationtheseindividualsaudiomainbritishcongressalternativefreedomtheirappearsintokeepprincess dianabridgewwiiifilmanalysislicencekingthree21transportfreemasonmaterialbankingverywelllostmplandchangeslistassassinationslisted by googlegetsonetimesisraelipulledwwwbilderbergorgmassiveincludingmafiamenjournalistlistedcensoredavailabledemocracy6cultitssecretnationalbilderberg 2000helpentireoutfreebombingsnetworkcamepleasemy researchallinternetterms1 2war crimesundiscussionscentral3conspiracycookalongcommoners kingadolfgroupcrimeprojectprincessagechairmanpartyusedhomebankstersbigjournalistspotentialtimeblairsthreatfindnumberdeathdealfeelclandestinestateschristianfascismhidden historyconnectionslistenpsyopsgoodgettingbombpeople77 london17websiteministerattemptglobal eliteofficialmeetingsformercrisisdanielken clarkenatoinvestigativeforumreportsreportadamvideosshouldlondon bombingsbehindsupportterrorcharterkissingerattacksrockefelleroncedocumentbilderberg conferencesactsqueengeorgemartinscotlandwhetherencourageseemscoupstringnamestillfulluk16tellmarkevilanotherbilderberg 2011webgovernmentdemandsterroristhadlatestradionational securityyou canreadgroupsbohemian grovethey cameforeignwe want14wantsintelligencesomemyciamediasecretarywanthiddenspecificquotthe19closesearch engineselectionpublishedotherprofbridge notbilderberg meetingapprovedbilderberg emailterroristsanygchqbbcmustabovegooglehardlongaprilcivildailybusinessbilderberg conferenceclubthingworld war iiiamericanworldroyalempirespeculationpublicstopplacearticlesdennismostnukesmoremagicaroundsecurityinstitutionskillingconferencenot privatewereworkmodernnazismancontrolnazinoglobalterrorismgreateverwaybohemiandownload0likedocumentariescoveragerightgetgardenenglishbriefingpaulsecondappears on myrelationscriminalevenreallawmoneywithininfluencedianacontentenginejohn dournatos7thenaugust1thinkyearscouldcorporateculturalsecrecydiscussionbooksitedontbaseduk bilderbergrightlyfactsfirstdavidsaidyoutubewarfareilluminatigtagendabombsthreatsorderwhichalso

Longtail Keyword Density for Bilderberg.org

KeywordsOccurences
77 london bombings4
english civil war4
skull and bones4
world war iii4
1 2 33
bridge not far3
council on foreign3
google search engine3
appears on my3
listed by google3
you can9
power elite7
world war7
bilderberg conferences6
if you6
bilderberg conference6
my bilderberg6
prince charles6
london bombings6
77 london5
bilderberg group5
public transport5
civil war5
bilderberg meeting5
search engines5
british army5
english civil4
participant list4
foreign relations4
bilderberg email4
1 24
national security4
has been4
war iii4
false flag4
princess diana4
search engine4
united states3
my research3
bohemian grove3
radio shows3
we want3
david rockefeller3
bilderberg 20003
google search3
not private3
mind control3
london underground3
global elite3
state terror3
john d3
ken clarke3
dennis wheatley3
not far3
bridge not3
scotland yard3
email list3
2 33
uk press3
war crime3
bilderberg 20113
uk bilderberg3
they came3
commoners king3
hidden history3
bilderberg108
amp60
my49
uk38
site37
war36
not31
world30
we24
you24
us23
they22
press22
secret22
elite21
but21
nazi20
bbc20
all20
power19
public18
their18
conference18
page18
have18
london18
people17
can17
016
so15
google15
one15
british15
media15
do15
has14
some14
114
me13
up13
list13
here13
out13
213
search13
website12
there12
email12
its12
state12
his12
which12
far11
information11
john11
global11
no11
human11
news11
control11
being11
new11
terror11
charles11
see10
prince10
private10
meeting10
our10
israeli9
been9
david9
mirror9
freedom9
conspiracy9
security9
nazis9
39
these9
years9
over9
get9
terrorism9
mi69
want9
more9
political8
behind8
army8
then8
like8
first8
under8
money8
government8
illuminati8
hidden8
your8
market8
economic8
now8
48
58
into8
club7
free7
available7
wwwbilderbergorg7
nato7
royal7
cia7
great7
tv7
use7
them7
good7
powerful7
if7
watch7
research7
conferences7
civil7
group7
police7
inside7
before7
history7
martin7
index7
censorship7
european7
crisis7
former6
participant6
three6
foreign6
such6
latest6
democracy6
real6
black6
against6
service6
network6
had6
connections6
were6
international6
help6
used6
general6
audio6
know6
bush6
threats6
big6
download6
oil6
article6
western6
without6
because6
dont6
mi56
intelligence6
quotthe6
radio6
evidence6
forum6
talk6
only6
bristol6
masonic6
time6
archive6
top6
bombings6
evil6
assassination6
full6
terrorist5
youtube5
business5
software5
land5
lists5
national5
meetings5
english5
bilderbergers5
american5
mind5
diana5
princess5
exposed5
paul5
king5
lies5
groups5
mafia5
death5
book5
bones5
ken5
transport5
car5
false5
clandestine5
long5
other5
project5
most5
still5
came5
rich5
revelation5
terrorists5
iran5
adam5
right5
various5
place5
after5
george5
pepis5
65
also5
engine5
engines5
googles5
specific5
take5
75
articles5
personal5
men5
relations5
85
should5
june5
agenda5
material5
many5
web5
hitlers4
rockefeller4
empire4
paper4
hacking4
city4
speculation4
may4
family4
weapons4
investigative4
bulletin4
d4
financial4
analysis4
deal4
bormann4
open4
party4
psyops4
mainstream4
individuals4
very4
work4
knowledge4
please4
down4
known4
along4
bilderbergorg4
industry4
content4
iii4
even4
facts4
much4
well4
am4
seems4
corporate4
gets4
internet4
bohemian4
back4
own4
grove4
skull4
oosterbeek4
origins4
discussion4
94
any4
must4
just4
selection4
shows4
mp4
keep4
murder4
clarke4
modern4
commission4
killing4
104
way4
ex4
eu4
114
old4
magic4
dennis4
abuse4
coverage4
order4
report4
reports4
above4
briefing4
attacks4
124
scotland4
ever4
antichrist4
flag4
true4
coup4
changes4
act4
military4
wwiii4
law4
two4
too4
happened4
journalists4
services4
crime4
bank4
journalist4
censored4
age3
removed3
server3
warfare3
culture3
cultural3
fascism3
home3
natos3
altavista3
documentaries3
legal3
mossad3
thing3
133
disappeared3
chairman3
gchq3
rightly3
dr3
natonazi3
whole3
threat3
below3
pulled3
months3
whether3
bosses3
appears3
hard3
best3
string3
find3
notice3
pages3
143
italian3
defense3
believe3
enclosure3
green3
caught3
few3
code3
encourage3
since3
criminal3
once3
future3
wants3
mark3
necessity3
united3
company3
states3
licence3
published3
closed3
getting3
alternative3
charter3
does3
cook3
main3
going3
fact3
view3
times3
end3
council3
he3
document3
secrecy3
secretary3
freemasonry3
name3
influence3
potential3
able3
another3
asked3
153
interview3
slavery3
attempt3
taking3
163
surveillance3
including3
official3
etc3
read3
feel3
around3
wheatley3
terms3
rights3
biblical3
birmingham3
central3
nbsp3
-gt3
august3
videos3
officer3
ii3
breivik3
calls3
underground3
next3
hitler3
agencies3
173
jonathan3
usa3
lost3
committee3
183
cult3
commoners3
through3
job3
policy3
assassinations3
murdered3
daily3
christian3
193
banking3
garden3
within3
freemason3
support3
pdf3
entire3
could3
capital3
demands3
nuclear3
kissinger3
chief3
congress3
discussions3
why3
listen3
founder3
approved3
prof3
lord3
al3
nukes3
hour3
bombs3
203
minister3
213
think3
explosives3
banksters3
yard3
sun3
blairs3
politicians3
wanted3
said3
arnhem3
traitors3
institutions3
223
close3
acts3
crimes3
rulers3
transatlantic3
truth3
worlds3
start3
massive3
arms3
233
bombing3
number3
savile3
based3
second3
queen3
adolf3
man3
planted3
april3
same3
amazing3
film3
hear3
become3
10th3
stop3
daniel3
father3
documentary3
bomb3
tell3
person3
operation3
post3
bridge3
243
freemasons3
meltdown3
listed3