0451bx.cn0451bx.cn

Add a review Follow site

Safety: Low trust score

Year Founded: 2008

Global Traffic Rank: Unknown

Estimated Worth: $9

Last updated:2020-10-30

Category: This site has not been categorized yet

Expand details Add category Claim this site

0451bx

Add a review Follow (0)

Domain summary

Domain label	0451bx
Domain extension	cn
Domain registered:	2008-10-12
Domain updated:	2020-10-30
Domain expires:	2021-10-12
Global Traffic Rank	0
Statvoo Rating	I
Trust Score	Low Trust Score
Estimated worth	$9
Estimated daily income	$0
Estimated monthly income	$0

Rank summary

How is 0451bx.cn ranked relative to other sites:

Percentage of visits to 0451bx.cn from a search engine:

Frequently Asked Questions (FAQ)

Q: When was 0451bx.cn registered?

A: 0451bx.cn was registered 12 years, 3 months, 1 week, 5 days, 6 hours, 6 minutes ago on Sunday, October 12, 2008.

Q: When was the WHOIS for 0451bx.cn last updated?

A: The WHOIS entry was last updated 2 months, 3 weeks, 4 days, 6 hours, 6 minutes ago on Friday, October 30, 2020.

Q: What are 0451bx.cn's nameservers?

A: DNS for 0451bx.cn is provided by the following nameservers:

dns21.hichina.com
dns22.hichina.com

Q: Who is the registrar for the 0451bx.cn domain?

A: The domain has been registered at China NIC.

Q: What is the traffic rank for 0451bx.cn?

A: 0451bx.cn has a Low Trust Score, and a Statvoo Rank of I.

Q: How many people visit 0451bx.cn each day?

A: 0451bx.cn receives approximately 0 visitors and 0 page impressions per day.

Q: What IP address does 0451bx.cn resolve to?

A: 0451bx.cn resolves to the IPv4 address 103.244.90.165.

Q: In what country are 0451bx.cn servers located in?

A: 0451bx.cn has servers located in the Hong Kong SAR China.

Q: What webserver software does 0451bx.cn use?

A: 0451bx.cn is powered by WWW Server/1.1 webserver.

Q: Who hosts 0451bx.cn?

A: 0451bx.cn is hosted by Royal Network Technology Co., Ltd. in Guangzhou in Hong Kong.

Q: How much is 0451bx.cn worth?

A: 0451bx.cn has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

0451bx.cn Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

0451bx.cn Free SEO Report

Website Inpage Analysis for 0451bx.cn

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

0 :

Google Adsense

Not Applicable

Google Analytics

Not Applicable

Links - Internal

Links - Internal (nofollow)

Links - Outbound

Links - Outbound (nofollow)

Keyword Cloud for 0451bx.cn

varweekday elseelseelse ifmyweekdayifmyweekdayweekdayweekday else ifmyweekday

Longtail Keyword Density for 0451bx.cn

Keywords	Occurences
weekday else ifmyweekday	6
weekday else	6
else ifmyweekday	6
weekday	8
ifmyweekday	7
else	7
var	3

Who hosts 0451bx.cn?

0451bx.cn Hosting Provider Information

Hosted IP Address:	103.244.90.165
Hosted Hostname:	103.244.90.165
Service Provider:	Royal Network Technology Co., Ltd. in Guangzhou
Hosted Country:	HK
Location Latitude:	22.25
Location Longitude:	114.1667
Webserver Software:	WWW Server/1.1

Is "Royal Network Technology Co., Ltd. in Guangzhou" in the Top 10 Hosting Companies?

Name

Percentage

GoDaddy.com, LLC

9.5100%

DoD Network Information Center

8.4509%

Google Inc.

2.8338%

Confluence Networks Inc

2.6217%

Amazon.com, Inc.

2.1737%

Namecheap, Inc.

2.1384%

TOT Public Company Limited

1.5665%

1&1 Internet AG

1.5512%

Merit Network Inc.

1.3856%

Unified Layer

1.3043%

HTTP Header Analysis for 0451bx.cn

Http-Version:	1.1
Status-Code:	200
Status:	200 OK
Date:	Fri, 30 Oct 2020 07:10:28 GMT
Server:	WWW Server/1.1
X-Powered-By:	ASP.NET
X-AspNet-Version:	2.0.50727
Cache-Control:	private
Content-Type:	text/html
Content-Length:	76997
X-Safe-Firewall:	zhuji.360.cn 1.0.8.8 F1W1

0451bx.cn Domain Nameserver Information

Host	IP Address	Country
dns21.hichina.com	106.11.211.67
dns22.hichina.com	106.11.141.118

Need to find out who hosts 0451bx.cn?

Domain Registration (WhoIs) information for 0451bx.cn

 Domain Name: 0451bx.cn
ROID: 20081012s10001s81846000-cn
Domain Status: ok
Registrant: 郭雪峰
Registrant Contact Email: Login to show email
 Registrar: 阿里巴巴云计算（北京）有限公司
Name Server: dns21.hichina.com
Name Server: dns22.hichina.com
Registration Time: 2008-10-12 16:30:56
Expiration Time: 2021-10-12 16:30:56
DNSSEC: unsigned