112amersfoort.nl  |  112 Amersfoort - Het laatste 112 nieuws uit Amersfoort
Low trust score  | 
Actueel 112 nieuws uit Amersfoort, Hoogland, Hooglanderveen en Leusden.

112amersfoort.nl Website Information

112amersfoort.nl has a Low Trust Score, a Statvoo Rank of I, an Alexa Rank of 5,738,968, a Majestic Rank of 0, a Domain Authority of 24% and is not listed in DMOZ.

112amersfoort.nl is hosted by XL Internet Services B.V. in Netherlands.
112amersfoort.nl has an IP Address of 89.31.103.61 and a hostname of vps48924.public.cloudvps.com and runs Apache/2.2.22 web server.

The domain 112amersfoort.nl was registered 201 decades 8 years 9 months ago by Stichting Internet Domeinregistratie NL, it was last modified 201 decades 8 years 9 months ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for 112amersfoort.nl

Full Whois Lookup for 112amersfoort.nl Whois Lookup

Domain name: 112amersfoort.nl
Status: active

Registrar:
Metaregistrar B.V.
Zuidelijk Halfrond 1
2801DD Gouda
Netherlands

Abuse Login to show email
yes

Domain nameservers:
ns2.dn-s.nl
ns1.dn-s.nl

Record maintained by: NL Domain Registry

Copyright notice
No part of this publication may be reproduced, published, stored in a
retrieval system, or transmitted, in any form or by any means,
electronic, mechanical, recording, or otherwise, without prior
permission of the Foundation for Internet Domain Registration in the
Netherlands (SIDN).
These restrictions apply equally to registrars, except in that
reproductions and publications are permitted insofar as they are
reasonable, necessary and solely in the context of the registration
activities referred to in the General Terms and Conditions for .nl
Registrars.
Any use of this material for advertising, targeting commercial offers or
similar activities is explicitly forbidden and liable to result in legal
action. Anyone who is aware or suspects that such activities are taking
place is asked to inform the Foundation for Internet Domain Registration
in the Netherlands.
(c) The Foundation for Internet Domain Registration in the Netherlands
(SIDN) Dutch Copyright Act, protection of authors' rights (Section 10,
subsection 1, clause 1).

Who hosts 112amersfoort.nl?

112amersfoort.nl Web Server Information

Hosted IP Address:89.31.103.61
Hosted Hostname:vps48924.public.cloudvps.com
Service Provider:XL Internet Services B.V.
Hosted Country:NetherlandsNL
Location Latitude:52.3667
Location Longitude:4.9
Webserver Software:Apache/2.2.22

HTTP Header Analysis for 112amersfoort.nl

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 12 Dec 2015 09:47:01 GMT
Server: Apache/2.2.22
X-Powered-By: PHP/5.4.45-0 deb7u2
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
P3P: policyref="http://112amersfoort.nl/index.php/p3p", CP="NOI DSP COR NID PSA ADM OUR IND NAV COM"
X-Content-Type-Options: nosniff
X-XSS-Protection: 1; mode=block
X-Frame-Options: sameorigin
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 15781
Content-Type: text/html; charset=utf-8


Need to find out who hosts 112amersfoort.nl?

112amersfoort.nl Free SEO Report

Website Inpage Analysis for 112amersfoort.nl

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:pub-3005154539437513
Google Analytics:Not Applicable

Keyword Cloud for 112amersfoort.nl

manwerdwoninginbrakenschoorsteenbrandheeftopdenlaatste15 woninginbrakenforse brand bijdiezaakanneweekrondhebbeninbrakenuitverschillendeseptembertweeomtrentongevalsteeds vermistwoninginbraken gepleegdnbsp 0610vragen omtrentvermissinggevondenbrandweervermissing anne faberbedrijf aan0610doldernogaanrijdingamersfoort nbspopoktoberargonwegdezevermissing annebij huisook27jarige manreacties nbspmetaalverwerkingsbedrijfamersfoortaangehoudenomtrent vermissing annehet waternieuwsgewond bijbij metaalverwerkingsbedrijf aanvan anneuurdirectfietsermetaalverwerkingsbedrijf aanfaber reacties nbspnaarwolframkadeeraan de wolframkadea1den dolderafgelopen weekvoor vandaagadvertentiesgestaaktvermiste anne faber0710ter heideafgelopenautoutrechtforse brandverdachtebij huis ter0310van anne fabertussenvoorreactieszouniethijbij metaalverwerkingsbedrijfomtrent vermissingfaber reactiesnog steeds vermistmetaan de argonwegjongenzoektochtsteedsamersfoort reactieseenvermistzoekactieleeswaternbspnog steedsman diebrandnbspopzaterdagfietser gewond0810huis terfileanne faber reactiesbedrijfnaar de vermistevermistemeer0naterhuisom1vermiste anne15 woninginbraken gepleegdvragenforsenbsp 0310nijkerkonbekendebrand bijzondaggewondfaberfietser gewond bij27jarigehetvanhuis ter heideannepolitienaar anneagenda2xvan hetzatvan eengepleegdvandaagnbspdeonderzoek2heidelees verderbijzijnanne faberaanzoekactie naargepleegd in amersfoortvragen omtrent vermissingtebrand bij metaalverwerkingsbedrijfreacties nbsp 0310verdermeisjesradiumweggisterenreacties nbsp 0610aangetroffendoorhet ongevaluonder

Longtail Keyword Density for 112amersfoort.nl

KeywordsOccurences
huis ter heide6
reacties nbsp 06105
faber reacties nbsp4
anne faber reacties4
vermiste anne faber4
nog steeds vermist3
aan de argonweg3
naar de vermiste3
bij huis ter3
van anne faber3
forse brand bij3
brand bij metaalverwerkingsbedrijf3
gepleegd in amersfoort3
15 woninginbraken gepleegd3
fietser gewond bij3
vermissing anne faber3
omtrent vermissing anne3
vragen omtrent vermissing3
aan de wolframkade3
bij metaalverwerkingsbedrijf aan3
reacties nbsp 03103
anne faber20
reacties nbsp18
huis ter7
lees verder7
ter heide6
van anne6
nbsp 06105
naar anne5
vermiste anne4
amersfoort -nbspop4
den dolder4
faber reacties4
brand bij4
amersfoort reacties3
zoekactie naar3
steeds vermist3
het ongeval3
van het3
voor vandaag3
bij huis3
bedrijf aan3
forse brand3
nog steeds3
27-jarige man3
man die3
van een3
woninginbraken gepleegd3
15 woninginbraken3
afgelopen week3
gewond bij3
fietser gewond3
het water3
vermissing anne3
omtrent vermissing3
vragen omtrent3
metaalverwerkingsbedrijf aan3
bij metaalverwerkingsbedrijf3
nbsp 03103
027
anne27
nbsp27
van27
een25
het23
faber21
amersfoort20
reacties19
bij17
op15
naar14
politie13
voor12
met11
aan11
na10
man8
ter8
lees7
verder7
werd7
huis7
vandaag7
aanrijding7
zaterdag6
nog6
heide6
die6
zondag6
te6
16
oktober6
september6
uit6
aangehouden5
heeft5
zoektocht5
vermiste5
verdachte5
zoekactie5
06105
woninginbraken5
vermissing5
forse5
door5
vermist5
twee5
rond5
-nbspop5
zou5
bedrijf5
uur5
ongeval5
fietser5
brandweer4
hebben4
08104
gisteren4
hij4
den4
dolder4
brand4
ook4
meer4
gepleegd4
gewond4
07104
utrecht4
zijn4
om4
aangetroffen4
deze4
file3
gevonden3
verschillende3
a13
onbekende3
gestaakt3
direct3
argonweg3
niet3
onderzoek3
03103
laatste3
inbraken3
steeds3
schoorsteenbrand3
agenda3
metaalverwerkingsbedrijf3
wolframkade3
-nbspde3
vragen3
omtrent3
jongen3
23
water3
radiumweg3
auto3
afgelopen3
onder3
week3
er3
nieuws3
2x3
tussen3
u3
zaak-anne3
zat3
nijkerk3
meisjes3
27-jarige3
advertenties3

What are the nameservers for 112amersfoort.nl?

112amersfoort.nl Domain Nameserver Information

HostIP AddressCountry
ns2.dn-s.nl 141.138.198.56Netherlands Netherlands
ns1.dn-s.nl 80.84.224.44Netherlands Netherlands

112amersfoort.nl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if 112amersfoort.nl is a scam?