1177 Vårdguiden

Safety: Low trust score
Year Founded: 2006
Global Traffic Rank: 18,198
Estimated Worth: $835,920
Category: News and Media

Läs om hälsa, sjukdomar och att hitta vård på 1177.se. Logga in för att göra dina vårdärenden. Ring 1177 för sjukvårdsrådgivning.



Domain summary

Last updated
2021-08-26
Domain label
1177
Domain extension
se
Domain registered:
2006-06-09
Domain updated:
2021-08-26
Domain expires:
2022-08-08
Global Traffic Rank
18,198
Statvoo Rating
C
Trust Score
Low Trust Score
Estimated worth
$835,920
Estimated daily income
$1,161
Estimated monthly income
$35,314

Frequently Asked Questions (FAQ)

Q: When was 1177.se registered?
A: 1177.se was registered 15 years, 7 months, 1 week, 2 days, 18 hours, 44 minutes, 21 seconds ago on Friday, June 9, 2006.
Q: When was the WHOIS for 1177.se last updated?
A: The WHOIS entry was last updated 4 months, 3 weeks, 2 days, 18 hours, 44 minutes, 21 seconds ago on Thursday, August 26, 2021.
Q: What are 1177.se's nameservers?
A: DNS for 1177.se is provided by the following nameservers:
  • dns01.dipcon.com
  • dns02.ports.se
  • dns03.ports.se
  • ns1.p10.dynect.net
  • ns2.p10.dynect.net
Q: Who is the registrar for the 1177.se domain?
A: The domain has been registered at NIC-SE.
Q: What is the traffic rank for 1177.se?
A: 1177.se ranks 18,198 globally on Alexa. 1177.se has a Low Trust Score, and a Statvoo Rank of C.
Q: How many people visit 1177.se each day?
A: 1177.se receives approximately 96,714 visitors and 580,284 page impressions per day.
Q: What IP address does 1177.se resolve to?
A: 1177.se resolves to the IPv4 address 193.234.44.170.
Q: In what country are 1177.se servers located in?
A: 1177.se has servers located in the Sweden.
Q: What webserver software does 1177.se use?
A: 1177.se is powered by webserver.
Q: Who hosts 1177.se?
A: 1177.se is hosted by Crystone AB in Sweden.
Q: How much is 1177.se worth?
A: 1177.se has an estimated worth of $835,920. An average daily income of approximately $1,161, which is roughly $35,314 per month.

1177.se Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

1177.se Free SEO Report

Website Related Search Terms

Website Inpage Analysis for 1177.se

H1 Headings

3 :
  1. 1177 Vårdguiden
  2. Covid-19 - vaccinera dig för din och andras skull
  3. 1177 Vårdguiden

H2 Headings

2 :
  1. Aktuella artiklar
  2. - tryggt om din hälsa och vård

H3 Headings

4 :
  1. Så hittar du lössen
  2. Ändra dina alkoholvanor
  3. Så tvättar du händerna
  4. Bedragare påstår att de är från 1177 Vårdguiden

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

6 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

26:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for 1177.se

behandlingvarastdslutet avring 1177r frnvaccinsom duhjlpmedelbesvrkroppennsaefterdinstd vidannattyplkemedel plogga in frpsykologiskdrycknr dusjukdomar ochloggaslutettloadcssron nsa ochgr detvrdaktivitetdu tarsmrtafungerarhemmapersonmersjlvsverige omoch psykologiskp rttsjukdomkostarslutaavfoumlrkan jagmrdetdig somatt varainomnrstende tillfaringrbarnetsron nsahittasigvillngon somgraviditetpoch attatt de rtvttaroch fmot hepatitnrrtmediaharfr dinsverigeruntolikanr manverdusom harstd ochbarn mrhos barndinasttetttill ngon somfrstadig som rtvttar duviblismrtlindring vidbarn ochhnderhittargulautvecklingfinnsvidatt taprovepolyatt dusmfunctionandraampjagsjukdomarinte rfnyftthos smfr ettoch hurtillfungerar detvaccin motsjukoch andraav personerftttsmrtlindringpsykiskdittringonthandfrnurav medrdrttdu blirprov ochhjrtatmotfrlderveckamoch dryckhur duoch std vidngonellersom du tarett nyfttsamband medtill diggenomatt fdadu inte rnyfdda0du rinnehll frnkangrahaav typsverige om dutill dig somesupportska1177se loggahurhos barn ochblirom du rinfektioninnehllkpa1177sesvarfoumlr attnr du roch sjukdomarkan duochmagenta1177 frlkemedelom dufr attatt blidu frnrstendering 1177 fruppunderoch stdnrstende till ngonhlsasometjnstervartill ngonprov och fnsa ochsambandinterondu harcovid19som rr frn 1177sm barntarrddpsykiatriskmedoch svarbarndigfrn 1177barnsattutvecklasmatdu kanpersonerdu intefdahrgrmagen hosomhoshepatitfrmanblode

Longtail Keyword Density for 1177.se

KeywordsOccurences
nr du r8
hos barn och7
till ngon som5
som du tar5
att de r4
r frn 11774
nrstende till ngon4
logga in fr3
sverige om du3
om du r3
ron nsa och3
dig som r3
och std vid3
ring 1177 fr3
till dig som3
prov och f3
du inte r3
hos barn15
om du11
du r11
barn och9
nr du9
som du8
kan du8
fr att7
att du7
ngon som6
och andra6
till ngon6
dig som6
sjukdomar och6
du tar6
som r6
du inte6
vaccin mot5
och std5
du har5
ett nyftt5
som har5
hos sm5
r frn5
mot hepatit4
magen hos4
fr ett4
samband med4
std vid4
och dryck4
nrstende till4
du fr4
frn 11774
och att4
inte r4
att bli4
av med4
hur du4
lkemedel p3
slutet av3
av typ3
ron nsa3
att vara3
nsa och3
och svar3
nr man3
kan jag3
1177se logga3
smrtlindring vid3
du kan3
1177 fr3
fr din3
prov och3
och f3
och hur3
du blir3
tvttar du3
p rtt3
av personer3
och sjukdomar3
foumlr att3
sm barn3
innehll fr3
std och3
och psykologisk3
barn mr3
till dig3
fungerar det3
ring 11773
att ta3
gr det3
att fda3
sverige om3
och277
hos107
du78
vid75
av71
fr58
att58
p55
mot51
om47
barn45
med44
r43
vecka42
som40
fungerar27
till26
eller23
under22
ett21
har20
nr19
f17
kan17
det15
frn15
din14
std13
dig13
efter13
ngon12
vara11
inte11
bli10
utveckling10
010
sm9
function9
andra9
sig9
var8
ta8
e8
jag8
sjukdomar7
lkemedel7
amp7
gr7
typ7
dina7
nrstende7
blir6
prov6
vill6
hur6
personer6
genom6
vrd6
tar6
mat5
gula5
logga5
nyftt5
ring5
sjlv5
ska5
foumlr5
magen5
vaccin5
hlsa5
infektion4
rd4
ur4
samband4
sjukdom4
olika4
besvr4
hnder4
epoly4
dryck4
mer4
aktivitet4
inom4
hemma4
m4
mr4
hjlpmedel4
innehll4
ditt4
hittar4
finns4
hepatit4
stt4
runt4
faringr4
smrta3
rdd3
sverige3
blod3
tloadcss3
kostar3
annat3
slutet3
ont3
t3
person3
ron3
nsa3
behandling3
kpa3
esupport3
tmedia3
gra3
ftt3
svar3
sluta3
ha3
tvttar3
rtt3
sjuk3
covid-193
hr3
hitta3
vi3
psykisk3
psykologisk3
psykiatrisk3
1177se3
hjrtat3
ver3
man3
e-tjnster3
graviditet3
kroppen3
fda3
nyfdda3
frsta3
smrtlindring3
hand3
barnets3
upp3
barns3
frlder3
utvecklas3
n3

Who hosts 1177.se?

1177.se Hosting Provider Information

Hosted IP Address:193.234.44.170
Hosted Hostname:193.234.44.170
Service Provider:Crystone AB
Hosted Country:SwedenSE
Location Latitude:59.3247
Location Longitude:18.056
Webserver Software:Not Applicable

Is "Crystone AB" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
19.8811%
GOOGLE
13.4918%
AS-26496-GO-DADDY-COM-LLC
3.5494%
NAMECHEAP-NET
3.0231%
AMAZON-AES
2.1497%
GoDaddy.com, LLC
2.0016%
UNIFIEDLAYER-AS-1
1.8740%
Fara Negar Pardaz Khuzestan
1.5314%
CONFLUENCE-NETWORK-INC
1.4027%
1&1 Internet AG
1.2887%
Crystone AB
0.0092%

HTTP Header Analysis for 1177.se

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache, must-revalidate
Pragma: no-cache
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server-Timing: intid;desc=cd7cec69e5508571
X-Request-URL: https://www.1177.se/
Strict-Transport-Security: max-age=31536000
X-Frame-Options: SAMEORIGIN
X-Content-Type-Options: nosniff
X-XSS-Protection: 1; mode=block
Referrer-Policy: strict-origin-when-cross-origin
Date: Thu, 26 Aug 2021 00:11:07 GMT

1177.se Domain Nameserver Information

HostIP AddressCountry
dns01.dipcon.com 193.14.90.50
dns02.ports.se 45.63.42.179
dns03.ports.se 94.237.33.102
ns1.p10.dynect.net 208.78.70.10
ns2.p10.dynect.net 204.13.250.10


Need to find out who hosts 1177.se?


Domain Registration (WhoIs) information for 1177.se

 # Copyright (c) 1997- The Swedish Internet Foundation.
# All rights reserved.
# The information obtained through searches, or otherwise, is protected
# by the Swedish Copyright Act (1960:729) and international conventions.
# It is also subject to database protection according to the Swedish
# Copyright Act.
# Any use of this material to target advertising or
# similar activities is forbidden and will be prosecuted.
# If any of the information below is transferred to a third
# party, it must be done in its entirety. This server must
# not be used as a backend for a search engine.
# Result of search for registered domain names under
# the .se top level domain.
# This whois printout is printed with UTF-8 encoding.
#
state: active
domain: 1177.se
holder: CP0000-07443
admin-c: dipcon0903-00017
tech-c: dipcon0903-00017
billing-c: dipcon0903-00017
created: 2006-06-09
modified: 2021-02-13
expires: 2021-08-08
transferred: 2009-03-07
nserver: dns01.dipcon.com
nserver: dns02.ports.se
nserver: dns03.ports.se
nserver: ns1.p10.dynect.net
nserver: ns2.p10.dynect.net
dnssec: signed delegation
registry-lock: unlocked
status: ok
registrar: Ports Group AB

Websites with Similar Names

1177.hk
click.com.cn
1177.net
1177 Vårdguiden
1177.org
1177.org domain name is for sale. Inquire now.
1177.se
1177 Vårdguiden

Recently Updated Websites

Knotfinishedcrafting.com (10 seconds ago.)Yokohama-home.com (13 seconds ago.)Reitverein-vinn.de (14 seconds ago.)Curatedcarts.com (14 seconds ago.)Evamansilla.com (14 seconds ago.)Petspawspa.com (19 seconds ago.)Turgic.com (20 seconds ago.)Likeagoodneighborstayoverthere.net (20 seconds ago.)Ybty685.com (25 seconds ago.)Dayaomaoyi.com (25 seconds ago.)Evansmed.com (27 seconds ago.)Grandmashousecharities.org (29 seconds ago.)Muabanserver.com (31 seconds ago.)Sonatorio.org (34 seconds ago.)Zeynepbingolciftci.com (35 seconds ago.)Cynthiagrush.com (41 seconds ago.)Thepancorp.com (42 seconds ago.)De-kong.com (43 seconds ago.)Dhp.org (45 seconds ago.)Tdev.org (46 seconds ago.)Helenahomevalue.casa (47 seconds ago.)Woodburningfireplaces.co.za (49 seconds ago.)Thegenrebox.com (52 seconds ago.)6vod.com (52 seconds ago.)Edgeconnect.org (1 minute ago.)Happyhustle.design (1 minute ago.)Donbio.com (1 minute ago.)Revisionconstruction.com (1 minute 1 second ago.)Dansego.com (1 minute 1 second ago.)Osborniifor5thdistrictlongbeach.com (1 minute 4 seconds ago.)

Recently Searched Keywords

phreakazoid (3 seconds ago.)function startclock function (4 seconds ago.)traject (6 seconds ago.)mbr系列-生活污水 (7 seconds ago.)architecture at night enter now (8 seconds ago.)saint louis du ha ha (10 seconds ago.)sed do eiusmod (20 seconds ago.)приказ №34 (23 seconds ago.)нашим правилам (29 seconds ago.)sweet and sour (31 seconds ago.)nordsee schleswig-holstein (37 seconds ago.)tiền vệ paul pogba nhiễm covid-19, man utd lại khốn đốn! (38 seconds ago.)reise- und kulturjournalistin (39 seconds ago.)bankassoc-kos (41 seconds ago.)chathams small animal hospital (45 seconds ago.)led+led (49 seconds ago.)saint louis du ha ha (49 seconds ago.)mocambo menu (52 seconds ago.)apple centerpieces (55 seconds ago.)黄色网站 (56 seconds ago.)mocambo menu (59 seconds ago.)kokedama comfire plant (59 seconds ago.)eeeeee (1 minute ago.)certification admin (1 minute 5 seconds ago.)flexi-bar benefits (1 minute 6 seconds ago.)bei 86 quellen (1 minute 7 seconds ago.)русско-английский (1 minute 14 seconds ago.)icon-with-text-shortcodeicon-text-id-3035b41f8cc79c2eb52496f80e8eaebe text-icondt-icon-hover-onhover (1 minute 15 seconds ago.)franklin football coach (1 minute 15 seconds ago.)laundered (1 minute 18 seconds ago.)