123-reg.co.uk  |  Domain name registration and web hosting services | 123-reg
High trust score  | 
From domains to web hosting, email and website builder - 123-reg, UK's largest registrar, makes it easy to get your personal or business website online.

123-reg.co.uk Website Information

123-reg.co.uk has a High trust score, a Statvoo Rank of B, an Alexa Rank of 10,582, a Majestic Rank of 792, a Domain Authority of 85% and is not listed in DMOZ.

123-reg.co.uk is hosted by Webfusion Internet Solutions in England, Derby, United Kingdom, De1 3ae.
123-reg.co.uk has an IP Address of and a hostname of www.123-reg.co.uk.

The domain 123-reg.co.uk was registered 1 decade 9 years 3 months ago by , it was last modified 4 years 3 months 2 weeks ago and currently is set to expire 201 decades 8 years 11 months ago.

Whois information for 123-reg.co.uk

Full Whois Lookup for 123-reg.co.uk Whois Lookup

Domain name:

Webfusion Limited

Registrant type:
UK Limited Company, (Company number: 5306504)

Registrant's address:
5 Roundwood Avenue
Stockley Park
UB11 1FF
United Kingdom

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 18-Apr-2013

123-Reg Limited t/a 123-reg [Tag = 123-REG]
URL: http://www.123-reg.co.uk

Relevant dates:
Registered on: 31-May-2000
Expiry date: 31-May-2025
Last updated: 04-Jul-2017

Registration status:
Registered until expiry date.

Name servers:

WHOIS lookup made at 08:12:24 08-Oct-2017

This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts 123-reg.co.uk?

123-reg.co.uk Web Server Information

Hosted IP Address:
Hosted Hostname:www.123-reg.co.uk
Service Provider:Webfusion Internet Solutions
Hosted Country:United KingdomGB
Location Latitude:52.9228
Location Longitude:-1.47663
Webserver Software:Not Applicable

HTTP Header Analysis for 123-reg.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 11 Jun 2015 00:06:18 GMT
Server: Apache/2.2.15 (CentOS)
Vary: Content-Type,Host,X-FORWARDED-SSL,User-Agent
X-Client-Version: f7fa0b709fe3251c929c1039acc8ed1ea2ca5a1a
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Need to find out who hosts 123-reg.co.uk?

123-reg.co.uk Free SEO Report

Website Inpage Analysis for 123-reg.co.uk

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for 123-reg.co.uk

allwordpressweresupporttraffic to yourwere hereyour websiteyouexperienceincreasedoproductsfind outfounddomain nameemail0your businessfreecustomeralwayslikebuiltoversecuregetpersonalisedeasyyou needpmserviceget foundyour domainmoreyour ownyourprofessionalonlineseowebsitesearchonline businesslocalstartuphostingfindcreatetheirhelp youuksusegrowourconnectedreliable123 regsucceedhavebuildowngreatbusinessregneedpricesmakehaswaygoogleus1nocustomerswellwhypm 20helpdomaintrafficsodomainsdo youweanyeverythingget onlinegoodsiteweb2millionmarketingkeepoutsitesnameherecookies

Longtail Keyword Density for 123-reg.co.uk

traffic to your4
your website12
your business10
pm 206
123 reg6
help you5
find out4
you need4
online business3
your own3
do you3
domain name3
your domain3
get found3
were here3
get online3

What are the nameservers for 123-reg.co.uk?

123-reg.co.uk Domain Nameserver Information

HostIP AddressCountry
ns.webfusion.co.uk Kingdom United Kingdom
ns2.webfusion.co.uk Germany

123-reg.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if 123-reg.co.uk is a scam?