www.123info.com.ar | Información de espectáculos y algo más...

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-12
Category: This site has not been categorized yet


Domain summary

Domain label
123info
Domain extension
com.ar
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is 123info.com.ar ranked relative to other sites:

Percentage of visits to 123info.com.ar from a search engine:


Frequently Asked Questions (FAQ)

Q: When was 123info.com.ar registered?
A: 123info.com.ar was registered 3 months, 5 days, 16 hours, 7 minutes, 24 seconds ago on Monday, October 12, 2020.
Q: When was the WHOIS for 123info.com.ar last updated?
A: The WHOIS entry was last updated 3 months, 5 days, 16 hours, 7 minutes, 24 seconds ago on Monday, October 12, 2020.
Q: Who is the registrar for the 123info.com.ar domain?
A: The domain has been registered at .
Q: What is the traffic rank for 123info.com.ar?
A: 123info.com.ar has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit 123info.com.ar each day?
A: 123info.com.ar receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does 123info.com.ar resolve to?
A: 123info.com.ar resolves to the IPv4 address 190.210.162.249.
Q: In what country are 123info.com.ar servers located in?
A: 123info.com.ar has servers located in the Argentina.
Q: What webserver software does 123info.com.ar use?
A: 123info.com.ar is powered by Apache webserver.
Q: Who hosts 123info.com.ar?
A: 123info.com.ar is hosted by S.A. in Buenos Aires, Tigre, Argentina, 1649.
Q: How much is 123info.com.ar worth?
A: 123info.com.ar has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

123info.com.ar Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

123info.com.ar Free SEO Report

Website Related Search Terms

Website Inpage Analysis for 123info.com.ar

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Who hosts 123info.com.ar?

123info.com.ar Hosting Provider Information

Hosted IP Address:190.210.162.249
Hosted Hostname:srvi249.allytech.com
Service Provider:S.A.
Hosted Country:ArgentinaAR
Location Latitude:-34.3538
Location Longitude:-58.5446
Webserver Software:Apache

Is "S.A." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
S.A.
0.0132%

HTTP Header Analysis for 123info.com.ar

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 12 Oct 2020 01:42:43 GMT
Server: Apache
X-Powered-By: PHP/5.3.3-7 squeeze29
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 252
Content-Type: text/html

123info.com.ar Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts 123info.com.ar?


Domain Registration (WhoIs) information for 123info.com.ar

Websites with Similar Names

123in.vn
123in, in trực tuyến theo nhu cầu
123inan.com
Xưởng in ấn giá rẻ tại TP.HCM【123inan.com】
123incentives.com
Online Platforms – Brandable Internet Solutions
123incomeacademy.net
Di?n ?àn rao v?t nhanh nh?t hi?n nay
123incomeacademy.org
123 Income Academy
123incomeprotection.net
Personalised email address, create an email address
123incometaxin.com
Page Not Found
123incometaxsoftware.com
123 Income Tax Software Inc. | Tax Services
123incontri.com
Trova un’avventura nella tua zona - 123incontri.com

Recently Updated Websites

Ecohit.site (2 seconds ago.)Jo-games.xyz (3 seconds ago.)Casmeda.org (4 seconds ago.)Vcleane.xyz (7 seconds ago.)W-e-b-s-i-t-e.online (7 seconds ago.)Viber4you.online (8 seconds ago.)Annuitylife.org (9 seconds ago.)Sparktoperspective.org (10 seconds ago.)Sanxuvang.xyz (14 seconds ago.)Centure.top (14 seconds ago.)Mantishouse.org (14 seconds ago.)Click360.org (15 seconds ago.)Turismiamo.org (18 seconds ago.)Mirrormirrorstyleshop.space (19 seconds ago.)Maoyue.org (20 seconds ago.)Yumiav.xyz (20 seconds ago.)Pandemicpreparednesspoopkit.org (22 seconds ago.)Guadalajaracon.org (22 seconds ago.)Standindunyasi.online (24 seconds ago.)Yule157.net (24 seconds ago.)Budvtonuse.online (25 seconds ago.)Ralphkohlerofficialwebsite.org (26 seconds ago.)Bslu.xyz (28 seconds ago.)Naimra7.org (28 seconds ago.)Mhinnovation.org (29 seconds ago.)Antoniogousgounis.org (30 seconds ago.)Maximizemoneyonline.xyz (31 seconds ago.)Offloading.org (31 seconds ago.)Artquitectura.org (31 seconds ago.)Northstudios.org (32 seconds ago.)

Recently Searched Keywords

piggy bank (1 second ago.)decatur (2 seconds ago.)brand tracking (3 seconds ago.)padre (3 seconds ago.)al-layl the night (3 seconds ago.)join waitlist (5 seconds ago.)roads (7 seconds ago.)eye protection (8 seconds ago.)5:07 تتصادم jodi simpson و valentina nappi مع رجل يعجبهما كثيرًا بعد ممارسة الجنس (11 seconds ago.)5:07 بطلة كمال الأجسام تستعرض عضلاتها وهي عارية الصدر وبزازها المكورة بارزة (12 seconds ago.)topbar (14 seconds ago.)cartadd (14 seconds ago.)pat (15 seconds ago.)ifredpacketcheckredeemdisplayvalidate true (16 seconds ago.)exam subjects (17 seconds ago.)google cloud (18 seconds ago.)5 bước làm cá thu một nắng rim nước dừa cả nhà cùng mê cá thu một nắng rim nước dừa được chế biến đơn giản nhưng vẫn đảm [...] (18 seconds ago.)may 10 (19 seconds ago.)autoplayhoverpausetrue (20 seconds ago.)macbook (21 seconds ago.)usersajaxcheck type (22 seconds ago.)zakrywa usta (24 seconds ago.)台湾剧 (24 seconds ago.)informační centra (25 seconds ago.)triple (25 seconds ago.)topbryshop (27 seconds ago.)renovations (28 seconds ago.)trickswizard (29 seconds ago.)ヤフオク! (30 seconds ago.)tab s7 tab (32 seconds ago.)