High End Streetwear & Sneakers – 152Store

Safety: Low trust score
Year Founded: 2016
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

152store.com streetwear online shop con i migliori brand di streetwear, una ricerca sulle nuove realtà Made in Italy e una selezione delle migliori sneakers worldwide



Domain summary

Last updated
2020-10-20
Domain label
152store
Domain extension
net
Domain registered:
2016-04-05
Domain updated:
2020-04-09
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was 152store.net registered?
A: 152store.net was registered 5 years, 2 months, 2 weeks, 4 days, 23 hours, 46 minutes, 21 seconds ago on Tuesday, April 5, 2016.
Q: When was the WHOIS for 152store.net last updated?
A: The WHOIS entry was last updated 1 year, 2 months, 2 weeks, 23 hours, 46 minutes, 21 seconds ago on Thursday, April 9, 2020.
Q: What are 152store.net's nameservers?
A: DNS for 152store.net is provided by the following nameservers:
  • dns1.dnshosting.it
  • dns2.dnshosting.it
  • ns3.host-it.it
Q: Who is the registrar for the 152store.net domain?
A: The domain has been registered at TUCOWS DOMAINS INC..
Q: What is the traffic rank for 152store.net?
A: 152store.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit 152store.net each day?
A: 152store.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does 152store.net resolve to?
A: 152store.net resolves to the IPv4 address 81.31.145.134.
Q: In what country are 152store.net servers located in?
A: 152store.net has servers located in the Italy.
Q: What webserver software does 152store.net use?
A: 152store.net is powered by Apache/2.2.15 (CentOS) webserver.
Q: Who hosts 152store.net?
A: 152store.net is hosted by Host SpA in Italy.
Q: How much is 152store.net worth?
A: 152store.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

152store.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

152store.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for 152store.net

H1 Headings

0 :

H2 Headings

1 :
  1.  

H3 Headings

9 :
  1. RESI GRATUITI SOPRA 100€
  2. SPEDIZIONI GRATUITE SOPRA 100€
  3. SPEDIZIONI IN 24/72 ORE
  4. ISCRIVITI ALLA NEWSLETTER
  5. resi garantiti
  6. Spedizione gratuita
  7. SPEDIZIONI IN 24/48H
  8. NEWSLETTER
  9. FOLLOW 152 STORE

H4 Headings

1 :
  1. Search latest trends and stay on top

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

15 :

Google Adsense

:
pub-9612322647557422

Google Analytics

:
UA-54302845-2

Links - Internal

60:

Links - Internal (nofollow)

0:

Links - Outbound

18:

Links - Outbound (nofollow)

0:

Keyword Cloud for 152store.net

else ifbcsffilterconfignamecartprivacybuttonsremoveclassselectedfunctioncartnew dategettimeoffdatanew0winboomrlinherittruejquerycurrenciesiftypeof callbackscriptreadystatedisplayliresiselectedlanguagemoneyformatcallback variftypeofuserlanguagecookiecurrencystoreattributescarrellonoteimportantinherit importantcallbackscriptpolicyiftypeof callback functionamountloadernullundefinedjqueryselectedcurrencytextcurrencycurrentcurrency152 store2splitdomainssopraelselylanguagesimagedropdowniconsswitcherlyisopenspedizioni1cookieal carrellovar152storeattributereturninternalreffunction var100 spedizionishoptypefalsemissingpriceifnewsletterbcsffiltermainconfigscarpetranslationcurrencyconvertallshopcurrencycallback functiondategettimeswitchereshopcurrencyalfalse elsekeyfunctionlylanguagesimagedropdownswitcherlyisopenfunctionkeytypeofvaluefalse else ifprivacy policyeurfunctionkey valuecurrencytranslation missingtransform

Longtail Keyword Density for 152store.net

KeywordsOccurences
false else if3
iftypeof callback function3
function var7
else if5
new dategettime4
al carrello4
152 store4
false else3
translation missing3
privacy policy3
100 spedizioni3
functionkey value3
callback var3
iftypeof callback3
callback function3
inherit important3
var42
function31
if24
return15
true14
else12
new8
08
17
name7
eur7
e7
policy6
null6
false6
type6
carrello6
callback6
off6
note5
cart5
jquerycurrencies5
iftypeof5
cookiecurrency5
spedizioni5
amount5
privacy4
dategettime4
key4
bcsffilterconfig4
resi4
loader4
splitdomains4
switcher4
jqueryselected-currencytextcurrencycurrentcurrency4
userlanguage4
script4
selectedlanguage4
data4
attributes4
ly-languages-image-dropdown-switcherly-is-open4
al4
ly-languages-image-dropdown-icons-switcherly-is-open4
scarpe4
shop4
currency4
shopcurrency4
store4
currencyconvertallshopcurrency3
23
cookie3
transform3
important3
inherit3
display3
attribute3
typeof3
152store3
sopra3
scriptreadystate3
internalref3
newsletter3
functioncart3
moneyformat3
value3
functionkey3
translation3
winboomrl3
undefined3
price3
missing3
li3
buttonsremoveclassselected3
bcsffiltermainconfig3

Who hosts 152store.net?

152store.net Hosting Provider Information

Hosted IP Address:81.31.145.134
Hosted Hostname:opsrdt01.colt-engine.it
Service Provider:Host SpA
Hosted Country:ItalyIT
Location Latitude:43.1479
Location Longitude:12.1097
Webserver Software:Apache/2.2.15 (CentOS)

Is "Host SpA" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
Host SpA
0.0014%

HTTP Header Analysis for 152store.net

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Tue, 20 Oct 2020 12:03:15 GMT
Server: Apache/2.2.15 (CentOS)
Location: https://www.152store.com
Content-Length: 310
Connection: close
Content-Type: text/html; charset=iso-8859-1

152store.net Domain Nameserver Information

HostIP AddressCountry
dns1.dnshosting.it 81.31.145.146
dns2.dnshosting.it 81.31.154.134
ns3.host-it.it 52.29.31.142


Need to find out who hosts 152store.net?


Domain Registration (WhoIs) information for 152store.net

 Domain Name: 152STORE.NET
Registry Domain ID: 2019088376_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucows.com
Updated Date: 2019-04-19T09:35:01Z
Creation Date: 2016-04-05T10:51:16Z
Registry Expiry Date: 2020-04-05T10:51:16Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: DNS1.DNSHOSTING.IT
Name Server: DNS2.DNSHOSTING.IT
Name Server: NS3.HOST-IT.IT
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-04-03T20:43:14Z

Websites with Similar Names

152stanford.com
For Sale: 152 Stanford Avenue, Mill Valley — Own Marin
152store.com
High End Streetwear & Sneakers – 152Store
152store.net
High End Streetwear & Sneakers – 152Store

Recently Updated Websites

Gadgetworld.us (2 seconds ago.)Patchanka.org (3 seconds ago.)Quantumsciencephilippines.com (3 seconds ago.)Vallouisepelvoux.com (4 seconds ago.)Yeisonrojas.com (5 seconds ago.)Hearear.org (6 seconds ago.)Ezansaat.com (6 seconds ago.)Ramgoseeds.site (7 seconds ago.)Yassshoney.com (7 seconds ago.)Sfpebblesstones.com (7 seconds ago.)Coffeeshopcompany.com (7 seconds ago.)Flextimelawyers.com (7 seconds ago.)Morada-group.com (8 seconds ago.)Eliteincus.com (9 seconds ago.)Dallastriallawfirm.com (9 seconds ago.)Trylivebet.us (10 seconds ago.)E-vestor.org (10 seconds ago.)Victor-uk.com (10 seconds ago.)Cczdsc.com (11 seconds ago.)Paycashforward.com (11 seconds ago.)Glamourstar-agency.com (11 seconds ago.)Oruschool.in (11 seconds ago.)Thebestofdaily.com (13 seconds ago.)Eumedhealthcare.com (14 seconds ago.)Darkmemediges.com (15 seconds ago.)Thepowerof.one (15 seconds ago.)Youngsmilestoday.com (15 seconds ago.)Mirabellejeux.com (15 seconds ago.)Ce-checker.info (16 seconds ago.)Manfrotto.com (16 seconds ago.)

Recently Searched Keywords

science notes in hindi (2 seconds ago.)chainid (6 seconds ago.)sports (9 seconds ago.)萌萌哒天团:萌妹子爱你么么哒 (19 seconds ago.)otros mbitos (20 seconds ago.)portable power station (29 seconds ago.)migliori (31 seconds ago.)style-k8ailaflsearchbox1252846306root searchbox2383127854input inputwithoptions1962082155inputcomponent (36 seconds ago.)14618 11:00 petite asian teen lulu chu wants to fuck best friends dad free x rated movies fuqer light bondage (39 seconds ago.)led avec variateur (45 seconds ago.)timingvalue mathrounddatavalue (56 seconds ago.)var options method (56 seconds ago.)thehousedesigners-9720 (56 seconds ago.)افلام رومانسية (58 seconds ago.)dl pulu (59 seconds ago.)refund policy (1 minute 3 seconds ago.)800w (1 minute 5 seconds ago.)common customer service crm metric (1 minute 13 seconds ago.)view product 7 (1 minute 15 seconds ago.)ham radio license exam (1 minute 16 seconds ago.)championship tips forebet (1 minute 19 seconds ago.)hdnyp (1 minute 19 seconds ago.)migliori creme (1 minute 20 seconds ago.)зарегистрироваться в качестве самозанятого можно через портал госуслуг (1 minute 22 seconds ago.)ehpad i foyers (1 minute 22 seconds ago.)「エル・ビューティアワード 2020」に投票して、スペシャル豪華賞品をゲット! (1 minute 23 seconds ago.)colectivos (1 minute 25 seconds ago.)cheap windows vps (1 minute 30 seconds ago.)252 251comp-k7o399gw members1982538223avatarsdefaultavatargroup2398042282---size-6-xsmall (1 minute 33 seconds ago.)sredozemno more (1 minute 40 seconds ago.)