1a.ee - NR 1 elektroonika internetipood Eestis!

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: 787,425
Estimated Worth: $2,160

1A.EE on Eesti üks suurimaid veebipoode pikaajalise kogemusega. Kvaliteetsed teenused ja parimad pakkumised.



Domain summary

Last updated
2021-03-23
Domain label
1a
Domain extension
ee
Global Traffic Rank
787,425
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$2,160
Estimated daily income
$9
Estimated monthly income
$274

Rank summary

How is 1a.ee ranked relative to other sites:

Percentage of visits to 1a.ee from a search engine:


Frequently Asked Questions (FAQ)

Q: When was 1a.ee registered?
A: 1a.ee was registered 3 weeks, 6 days, 3 hours, 35 minutes, 18 seconds ago on Tuesday, March 23, 2021.
Q: When was the WHOIS for 1a.ee last updated?
A: The WHOIS entry was last updated 3 weeks, 6 days, 3 hours, 35 minutes, 18 seconds ago on Tuesday, March 23, 2021.
Q: What are 1a.ee's nameservers?
A: DNS for 1a.ee is provided by the following nameservers:
  • ines.ns.cloudflare.com
  • dan.ns.cloudflare.com
Q: Who is the registrar for the 1a.ee domain?
A: The domain has been registered at .
Q: What is the traffic rank for 1a.ee?
A: 1a.ee ranks 787,425 globally on Alexa. 1a.ee has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit 1a.ee each day?
A: 1a.ee receives approximately 1,532 visitors and 3,064 page impressions per day.
Q: What IP address does 1a.ee resolve to?
A: 1a.ee resolves to the IPv4 address 104.26.8.224.
Q: In what country are 1a.ee servers located in?
A: 1a.ee has servers located in the United States.
Q: What webserver software does 1a.ee use?
A: 1a.ee is powered by CloudFlare webserver.
Q: Who hosts 1a.ee?
A: 1a.ee is hosted by TOT Public Company Limited in United States.
Q: How much is 1a.ee worth?
A: 1a.ee has an estimated worth of $2,160. An average daily income of approximately $9, which is roughly $274 per month.

1a.ee Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

1a.ee Free SEO Report

Website Related Search Terms

Website Inpage Analysis for 1a.ee

H1 Headings

0 :

H2 Headings

2 :
  1. {{ title }}
  2. Info

H3 Headings

22 :
  1. TV, audio, video, mängukonsoolid
  2. Telefonid, tahvelarvutid, Apple pood
  3. Arvutikomponendid, võrgutooted
  4. Arvutitehnika, bürootarbed
  5. Kodutehnika
  6. Parfüümid ja kosmeetika
  7. Ilu ja tervis
  8. Mööbel
  9. Sport ja fitness
  10. Lastele, imikutele
  11. Fototehnika, optika
  12. Auto- ja motokaubad
  13. Majapidamistooted
  14. Matka- ja turismitooted
  15. Santehnika ja kütteseadmed
  16. Kodu, aed ja remont
  17. Loomatarbed
  18. Tööriistad
  19. Valgustid
  20. Kingad, riided ja aksessuaarid
  21. Viimistlus- ja ehitusmaterjalid
  22. Kingitused, peokaubad

H4 Headings

4 :
  1. Mugav kauba toimetamine ja kättesaamine
  2. Garantii ja tagastus
  3. Erinevad makseviisid
  4. Klienditeenindus

H5 Headings

0 :

H6 Headings

4 :
  1. Tootegrupid
  2. E-poe teave
  3. Ettevõttest
  4. Leia meid sotsiaalmeedias

Total IFRAMEs

1 :

Total Images

154 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-3228902-5

Links - Internal

818:

Links - Outbound

4:

Links - Outbound (nofollow)

0:

Keyword Cloud for 1a.ee

pood telefonidtarvikud ekraani kaitsekiledespanderidelektrilised hambaharjadobjektiivid jaaedfreespingidtaime jaakudkik naistetarvikudlaste basseinikikgps video jalikekettadtoolidtervise ja hgieenitootedakulaadijad pistikudtolmuimejadvestidturismipksid jamikseridkevrud ja droonidlaste basseini jakassidele kassiliivlakidelektrilisedrsteridroomajatelekgi javikeloomadepallidturismidempridloe rohkemsantehnika ja ktteseadmedksitriistad aedajuuksehooldustootedkarbidstatiividtapeedid ja kleebisedja droonidmngudpduigeelmadratsidbinoklidtelefonid tahvelarvutidturismipksid ja lhikesedreisimiseksakud laadijadkgimikrofonidaluspurutassidprojektoridlegodempridloekodutehnikafoto spordikaamerad binoklidspordirivadseljakotid reisimisekso pnaiste nohooldustooted naistetarkvaravlisvalgustid vlisvalgustidbaaritarvikudprotsessoridnaiste nohooldustootedspordikellad ja kevrudarvutikomponendidhiiredspradespordikaameradtriistadkingad jaja tarkvaragps videoseinakinnitusedkik kosmeetikatootedipadilu ja tervistelerid ja tarvikudaksessuaarid naistenutikellad kevrudelugerid ja tarvikudriietus spordikelladkeha ja juuksehooldustootedtv audio videomeeste jalanudja muuksja aiasuksed aknadnaistevlisseadmedelektrimgironimisesaunad jafotopaberpikadveelpeegelkaameradaknad jakoertele kassideleauto jameestelenotreeningpuuridmagamiskotidmbel elutubapksid naistenaiste juuksehooldustootedjulutuledtelefonidkaitsekiled filmirullidjalanudturismitooted turism jaautoosadtahvelarvutid apple poodkaitsekiled filmirullid jneja motokaubadfototehnika optika fotobatuudidhekordsed nudkorvidja muudautoosad japarfmid ja kosmeetikaja lakidkotid statiividmeeste saapadktte javike kodutehnikakomponendidja veevarustusemuuja tellingudmeeste noinformatsioonkvakettadpannidtrenaridja mhkimineoptika fotoja motokaubad rehvidmbrised ekraaniribad energiasstlikud lambidkostmidaed ja remontobjektiivid ja vlklambidpksidjalgrattad ja tarvikudja jalatsidkoduelektriinstallatsioonijalanud jaja pannidmhkiminekorpus ja jahutuskarnevalisandaalidslearvutid jambrisedmatkatarvikud tahvelarvutidksitriistadaiavalgustidmultimeediaklaasidseljakotid reisimiseks jareisimineja turismijalatsidled pirnid ledpersonaalarvutid jakleebisprinteri lindidkarbid jaobjektiividja remontssdfitness srgidaudio videotelefonid tahvelarvutid appleja audioaiasmhkmed jamaterjalidtoitnohooldustooted naisteinterjrjuhtmega vrgutootedkelladesikautokeemiavlisseadmed jasgitarbedintegreeritavadlastele imikutelekosmeetikatootedgpsautokeemia japarfmid naistetarvikud naistetahvelarvutid applefotomultimeedia mngijadloomatarbedkohvimasinadlauamngudkorvid karbidjuhtmevabadfnidautolambidklmkapidgarantii jajalgrataste varuosadtahvelarvutidaksessuaaridpirnid ledkingitused peokaubadmobiiltelefonidespordikellad jafototehnikaremonttarvikud ilu jaturismiriietus ja jalatsidturismijalatsidadapterid valgusllitidnaistelefilmirullid jnetreening jaja paigaldustarvikudkodu aed jajuhtmevabad klaridplaystation 4hupallidvideo jatriietus ja jalatsidkleebisprinterispordi jalaadijad jaja ehitusmaterjalidkaablid juhtmedspordikelladtvvrgutoodete tarvikudvlised kvakettadtervisepistikudkorpus jatooteduksed aknad japersonaalarvutidaknadbasseini ja rannasussidpikad pksidteraddroonidpatareid akudnavigatsiooniseadmednaiste parfmidjakid jalid ja mrdeainedlutidviimistlus ja ehitusmaterjalidsuur kodutehnikasaapad javoodidpuhkuseks kodus jamuu vikeja kosmeetikaja pikadjalutuskikudeks jailu japlaystation 4 ps44 ps4 mngudriided jarehadkoertelekik tootedvannitoaloomatarbed koerteleplaystationtv tootederinevadvrgutootedapple pood telefonidemaplaadidarvutitehnikariided lastenukudkorpused tagakaanedledslearvutiteja sandaalidarvutitehnika brootarbedoptikaja lhikesedpuhastustarvikudmeeste parfmidlaadijad ja tarvikudspordikaamerad spordikaamerate tarvikudaudiotehnikamobiiltelefonide ja nutitelefonidenaiste retuusid lhikesedklaridelektritriistadtervise jakassiliiv jalaadijadusbbasseiniisolatsiooniksitriistad remondikspaadid ja kalapksaunad ja kerisedjuhtmevaba vrkvaatatarnenukud jadysonsvistatavadlisatarvikudakutrellid ning kruvikeerajadremondiksvabahumngudvarjukid objektiivid jaja kaablidnohooldustooted kikkrvaklapid juhtmevabad klaridktteturism ja reisiminesantehnika ja tarvikudnaiste retuusidmngukonsoolidmotokaubadja hgieenitootedja kalapkja kleebisedhiired klaviatuuridkaaludningautolego lauamngudkerisedja rannasussidnudkgikomplektidabrasiivid puurid teradsuurmngukonsoolid jaahjudja turismitooted turismlhikesed jakleebisedkorvid karbid jamngukonsoolid ja tarvikudlindudelepoodintegreeritav kodutehnikaps4 mngudtarvikud ilunud klaasidtv audiovlklambidaed jasporttriietus jaimetaminetahvelarvutiteklaasid jasisevalgustusvlisvalgustidjalatsitemacbookteleviisoridled pirnidlindidprinteridkgitehnikamototarvikudgarantiiehtedkingadruuteridvlisedmeeste saapad jakarbid ja kastidjalgrattadabrasiividspordikaamerate tarvikudja aksessuaarid naistepuurid teradspordijalatsidvarjukidmotoriietusturismhekordsedning kruvikeerajadja ktteseadmed santehnikakrvaklapidktteseadmedtypeehitusmaterjalidja tarvikud mngukonsoolidja varjukidkanalisatsioonja mrdeainedmuud tarvikudkuivtoitautositudeksja upsidredelidnutitelefonideja akutrellid ningmhkmed ja mhkiminevarjukid objektiividkrvaklapid juhtmevabadja puhastusvahendidmonitorid personaalarvutidtarvikud mngukonsoolidvikekgikombainidautokeemia ja puhastusvahendidspordikaamerad binoklidtelgidpesumasinadmnguasjad nukudarvutiklaridriietusteleridkodus ja aiasarvutikomponendid vrgutootedja tervispuhkuseks kodusfrontkosmeetika naistevrvid ja lakidjalutuskikudeksmeestekomplektidriided ja aksessuaaridnohooldustootedelutubaja jahutussaapadja katlakivieemaldusvahendidnutikelladjalanud kingadkingad riided jatervis meeste ilutootedimikutele lego mnguasjadtervis meesteautoosad ja tarvikudoptika foto spordikaameradmajapidamistootedtapeedid javrvidlhikesed ja pikadktteseadmed santehnikaspordikaamerad spordikaameratekinkekomplektidpuhkuseksakulaadijadturismiriidedkassiliivja trepidvideoregistraatoridnavigatsiooniseadmed javideokaardidredelid jajalatsite tarvikudlidrehvidribad energiasstlikudja nutitelefonidekgi ja sgitarbedkehariietus spordikellad kevrudfitness jalgrattad jaklmikudja tarvikud vannituppapeokaubadjuhtmevabajuhtmegaekraani kaitsekiledretuusid lhikesedsantehnikaslearvutid ja tarvikudnaiste jalanudkotid statiivid filtridlaste spordifototehnika optikaja kerisedkotid jalanudveevarustuse seadmedadapteridsuverehvidjaimikutelejuukselikusmasinadmuukspuhastus jaappletaime ja aiahooldustootedtahvelarvutid elugeridfitness jalgrattadserveridvrkfiltrid ja varjukidpood telefonid nutikelladkevrud jakaablidsantehnika jakotid jalanud javideo ja audioturism javabaajajalatsid meesteja tervis meestetagakaaned ja mbrisedkodutehnika vikevrgutoodeteuksedsport jaja autositudeksja reisiminenutitelefonide tarvikudstatiivid filtridja vlklambidarvutitehnika brootarbed slearvutidkik naiste juuksehooldustootedvabaajajalatsidlambidkaablid juhtmed jameeste ilutootedkruvikeerajadklaasid ja pannidturvalisusseadmedsolaariumikreemidpuldidrulluisudmngijadpatareidja tarvikud ilupuhastuskekelladkotidmonitoridrannasussidlhikesed pksidjuuksehooldustooted kikbrootarbed slearvutidtellingudspordikaameratekohviveskidarvutikomponendid vrgutooted komponendidmbrised ekraani kaitsekiledparfmid meestetreening ja fitnesskodusturismitooted turismredelid ja tellingudtahvelarvutid elugerid jameeste parfmid meesteja kevrudmatka ja turismijalatsidjakidvrvid jakodutehnika vike kgitehnikakassidelemobiiltelefonidaudioturismiriietusbrootarbed slearvutid jasgavklmikudmrdeainedlego mnguasjad nukudktte ja veevarustusejalgpalliseljakotidimikutele legofitnessparfmid kinkekomplektidja pikad pksidmobiiltelefonide jajalutuskikudeks ja autositudeksvalgustidoperatiivmlunaiste kehahooldustootedspordispordiriidedpaadid jalhikesedknlajaladkeha jalastekingad ja sandaalidjahutusja fitness srgidtagakaanedvideokvakettad ssdkastidja turismitootedpaadidkontoritoolidoslearvutidtelefonid nutikelladlastele imikutele legoparfmid jamnguasjad nukud japarfmid meeste parfmidvrgutooted komponendidapple poodja sgitarbedja riietusja adapteridviimistluspesumasinad frontilutootedupsidja fitness jalgrattadnaiste ilutootedkaitsekiled akulaadijadretuusid lhikesed ja4 ps4korpused tagakaaned jakksrgidkliimaseadmedkassidele kassiliiv jabrootarbedmonitorid personaalarvutid jakehahooldustooted kikled ribadakulaadijad pistikud jaja kastidkosmeetika naiste parfmidisolatsioonmngukonsoolid teleridpuhastus ja katlakivieemaldusvahendidretuusidintegreeritavvideo mngukonsoolid teleridvalgustid sisevalgustusjneja veevarustuse seadmedekraani kaitsekiled akulaadijadisolatsiooni javannituppakummutidmngukonsoolid telerid jamnguasjadja akutrellidps4aknad ja trepidauto ja motokaubadvideotehnikaja lhikesed pksidkarnevali kostmidramknladja muupotidparfmidja ktteseadmedpoolsaapadja riietus spordikelladtriistakomplektidfiltrid japcompareatpriceaiatmasinadja mbrisedkatlakivieemaldusvahendidkorpusedmeeste no kehatapeedidno keha jakehahooldustootedrohkemribadkevrudkorpusekraani kaitsekiled filmirullidjalanud ja riietusventilaatorid0elektri ja akutrellidkik meestefilmirullidlid jaklaviatuuridkotid jaturismitootedkosmeetikailumatka jastatiivid filtrid janavigatsiooniseadmed ja tarvikudkassiliiv ja aluspurulego mnguasjadetpersonaalarvutid ja upsidjuhtmed ja adapteridtervisaudio video mngukonsoolidpirnidoperatiivmlu rammagamistubalauagrillid rsteridppricevaruosadja kosmeetika naistemuud tarvikud ekraanija vestidvaata veeltriietusreisimiseks ja muukslauagrillidspordikellad kevrud jaelugeridja lauamngudvrkpalltagakaaned jamajapidamistarvikudhupuhastajadvike kgitehnikakingitusedfiltridaiahooldustootedkaitsmedenergiasstlikud lambidja fitnessja nutitelefonide tarvikudkalapksport ja fitnesskaitsekilednud klaasid japistikud jatarvikud ekraanisaapad ja poolsaapadkaladeleaedaja juuksehooldustootedja aksessuaaridmuu vike kgitehnikaja aluspurukonservidbasseini jasrgid lastelaste jalanudhambaharjadhgieenitootedturismipksidpistikupesadenergiasstlikudelektri jakingad riidedtelerid jadormeoviimistlus janutitelefonidvrkpalliaksessuaarid naiste jalanudvalgusllitidtoiteplokidelektriinstallatsiooni materjalidkotid ja mbrisedjuhtmed japlaadidreisimiseks jakodus jaturismiriietus jajalgratastepuhastusvahendidmatka ja turismitootedjalatsidktteseadmed santehnika jajalanud kingad jatarvikud vannituppatrepidspordi ja fitnessled ribad energiasstlikudlaste riidedno kehamlukaardidkontorimbelveevarustusenukud ja lauamngudisolatsiooni ja paigaldustarvikudradiaatoridja aiahooldustootedhddpaigaldustarvikudja poolsaapadpistikupesad pistikudteleviisorid seinakinnitusedtaimefoto spordikaameradja dempridmaiustusedelugerid jaja mbrised ekraanikaitsekiled akulaadijad pistikudvideo mngukonsoolidlambipesadmotokaubad rehvidlasteleekraaniriidedmhkmedtapeetlastetubaakutrellid ningja tarvikudpksid lastehabemeajamismasinadabrasiivid puuridlaste spordi jasaunadfitness srgid lastejalgrattad jalaste vabaajajalatsidakutrellidpistikud ja kaablidvikeloomadeleakud laadijad jakodu aedspordikellad kevrudpirnid led ribadmuudvlisseadmed ja tarkvarajuhtmedmbelmobiiltelefonid nutitelefonid

Longtail Keyword Density for 1a.ee

KeywordsOccurences
ja fitness srgid7
spordi- ja fitness7
tv audio video6
audio video mngukonsoolid6
kodu aed ja6
aed ja remont6
sport ja fitness6
ilu ja tervis6
santehnika ja ktteseadmed6
parfmid ja kosmeetika6
kingad riided ja6
jalanud kingad ja6
kingad ja sandaalid6
matka- ja turismitooted6
riided ja aksessuaarid6
telefonid tahvelarvutid apple6
auto- ja motokaubad6
tahvelarvutid apple pood6
viimistlus- ja ehitusmaterjalid5
kosmeetika naiste parfmid4
ja lhikesed pksid4
muu vike kgitehnika4
klaasid ja pannid4
ja kosmeetika naiste4
saunad ja kerised4
santehnika ja tarvikud4
mhkmed ja mhkimine4
lastele imikutele lego4
nud klaasid ja4
ja ktteseadmed santehnika4
meeste no- keha-4
no- keha- ja4
ja tarvikud vannituppa4
kodus ja aias4
jalutuskikudeks ja autositudeks4
ktteseadmed santehnika ja4
kgi- ja sgitarbed4
ja veevarustuse seadmed4
arvutitehnika brootarbed slearvutid4
puhkuseks kodus ja4
kotid ja mbrised4
krvaklapid juhtmevabad klarid4
apple pood telefonid4
puhastus- ja katlakivieemaldusvahendid4
ktte- ja veevarustuse4
turismipksid ja lhikesed4
keha- ja juuksehooldustooted4
lid ja mrdeained3
autokeemia ja puhastusvahendid3
korvid karbid ja3
paadid ja kalapk3
matka- ja turismijalatsid3
reisimiseks ja muuks3
seljakotid reisimiseks ja3
turismiriietus ja -jalatsid3
turism ja reisimine3
turismitooted turism ja3
ja turismitooted turism3
karbid ja kastid3
navigatsiooniseadmed ja tarvikud3
kassiliiv ja aluspuru3
isolatsiooni ja paigaldustarvikud3
naiste retuusid lhikesed3
uksed aknad ja3
tapeedid ja kleebised3
vrvid ja lakid3
fitness srgid laste3
laste spordi- ja3
saapad ja poolsaapad3
meeste saapad ja3
basseini- ja rannasussid3
laste basseini- ja3
ja pikad pksid3
lhikesed ja pikad3
retuusid lhikesed ja3
aksessuaarid naiste jalanud3
taime- ja aiahooldustooted3
ja aksessuaarid naiste3
ribad energiasstlikud lambid3
led ribad energiasstlikud3
pirnid led ribad3
led pirnid led3
akutrellid ning kruvikeerajad3
ja akutrellid ning3
elektri ja akutrellid3
abrasiivid puurid terad3
redelid ja tellingud3
gps video ja3
kassidele kassiliiv ja3
triietus ja jalatsid3
video ja audio3
varjukid objektiivid ja3
autoosad ja tarvikud3
monitorid personaalarvutid ja3
tahvelarvutid e-lugerid ja3
e-lugerid ja tarvikud3
arvutikomponendid vrgutooted komponendid3
korpus ja jahutus3
brootarbed slearvutid ja3
slearvutid ja tarvikud3
personaalarvutid ja ups-id3
akulaadijad pistikud ja3
vlisseadmed ja tarkvara3
kaablid juhtmed ja3
juhtmed ja adapterid3
kodutehnika vike kgitehnika3
meeste parfmid meeste3
parfmid meeste parfmid3
pistikud ja kaablid3
kaitsekiled akulaadijad pistikud3
naiste nohooldustooted naiste3
4 ps4 mngud3
video mngukonsoolid telerid3
mngukonsoolid telerid ja3
telerid ja tarvikud3
mngukonsoolid ja tarvikud3
ja tarvikud mngukonsoolid3
playstation 4 ps43
pood telefonid nutikellad3
ekraani kaitsekiled akulaadijad3
mobiiltelefonide ja nutitelefonide3
ja nutitelefonide tarvikud3
korpused tagakaaned ja3
tagakaaned ja mbrised3
ja mbrised ekraani3
mbrised ekraani kaitsekiled3
kik naiste juuksehooldustooted3
ja tarvikud ilu3
ja motokaubad rehvid3
filtrid ja varjukid3
fototehnika optika foto3
optika foto spordikaamerad3
foto spordikaamerad binoklid3
spordikaamerad spordikaamerate tarvikud3
kotid statiivid filtrid3
statiivid filtrid ja3
objektiivid ja vlklambid3
mnguasjad nukud ja3
akud laadijad ja3
laadijad ja tarvikud3
muud tarvikud ekraani3
tarvikud ekraani kaitsekiled3
ekraani kaitsekiled filmirullid3
kaitsekiled filmirullid jne3
nukud ja lauamngud3
lego mnguasjad nukud3
tarvikud ilu ja3
treening ja fitness3
ja tervis meeste3
tervis meeste ilutooted3
tervise- ja hgieenitooted3
ja fitness jalgrattad3
fitness jalgrattad ja3
jalgrattad ja tarvikud3
kotid jalanud ja3
imikutele lego mnguasjad3
jalanud ja riietus3
ja riietus spordikellad3
riietus spordikellad kevrud3
spordikellad kevrud ja3
kevrud ja droonid3
spordikellad ja kevrud3
aknad ja trepid3
ja tarvikud40
vaata veel19
ja fitness16
santehnika ja10
apple pood10
matka- ja9
vike kgitehnika8
ja adapterid7
spordi- ja7
fitness srgid7
muud tarvikud7
kik naiste7
ja mbrised7
ja turismitooted6
tv audio6
arvutikomponendid vrgutooted6
ja remont6
aed ja6
kodu aed6
klaasid ja6
ja motokaubad6
ja ktteseadmed6
ilu ja6
auto- ja6
kik tooted6
parfmid ja6
arvutitehnika brootarbed6
ja kosmeetika6
ja tervis6
ja aksessuaarid6
ekraani kaitsekiled6
meeste parfmid6
sport ja6
video mngukonsoolid6
lastele imikutele6
audio video6
naiste nohooldustooted6
kingad riided6
telefonid tahvelarvutid6
kik kosmeetikatooted6
tahvelarvutid apple6
fototehnika optika6
naiste parfmid6
ja sandaalid6
kingad ja6
jalanud kingad6
riided ja6
kik meeste6
naiste juuksehooldustooted5
ja lauamngud5
naiste kehahooldustooted5
monitorid personaalarvutid5
statiivid filtrid5
laadijad ja5
ksitriistad aeda5
kingitused peokaubad5
ja ehitusmaterjalid5
viimistlus- ja5
pksid laste5
juhtmevabad klarid5
patareid akud5
pistikud ja5
vrgutoodete tarvikud5
mhkmed ja4
ja autositudeks4
saunad ja4
jalutuskikudeks ja4
lhikesed pksid4
jakid ja4
ja mhkimine4
ja vestid4
ja muud4
imikutele lego4
ja demprid4
ktteseadmed santehnika4
tarvikud vannituppa4
ktte- ja4
veevarustuse seadmed4
karnevali kostmid4
ja lhikesed4
kodus ja4
ja aias4
ja pannid4
ja katlakivieemaldusvahendid4
puhastus- ja4
hekordsed nud4
loomatarbed koertele4
ja sgitarbed4
kgi- ja4
koertele kassidele4
pksid naiste4
nud klaasid4
puhkuseks kodus4
ja kerised4
ksitriistad remondiks4
ja veevarustuse4
led pirnid4
pistikupesad pistikud4
turismipksid ja4
garantii ja4
loe rohkem4
nohooldustooted kik4
parfmid meeste4
kleebisprinteri lindid4
parfmid kinkekomplektid4
kehahooldustooted kik4
meeste no-4
no- keha-4
krvaklapid juhtmevabad4
muu vike4
kosmeetika naiste4
pood telefonid4
integreeritav kodutehnika4
ja juuksehooldustooted4
lauagrillid rsterid4
brootarbed slearvutid4
kotid ja4
juuksehooldustooted kik4
keha- ja4
elektriinstallatsiooni materjalid3
led ribad3
pirnid led3
kaitsekiled akulaadijad3
vlisvalgustid vlisvalgustid3
mbrised ekraani3
adapterid valgusllitid3
tagakaaned ja3
valgustid sisevalgustus3
korpused tagakaaned3
ribad energiasstlikud3
energiasstlikud lambid3
akulaadijad pistikud3
akutrellid ning3
ja kaablid3
kassidele kassiliiv3
ja jahutus3
korpus ja3
vrgutooted komponendid3
taime- ja3
ja aiahooldustooted3
triietus ja3
ja jalatsid3
tarvikud tahvelarvutid3
e-lugerid ja3
kassiliiv ja3
ning kruvikeerajad3
ja aluspuru3
tahvelarvutid e-lugerid3
redelid ja3
ja tellingud3
abrasiivid puurid3
puurid terad3
elektri ja3
ja akutrellid3
naiste jalanud3
aksessuaarid naiste3
naiste retuusid3
nutitelefonide tarvikud3
vrvid ja3
playstation 43
tarvikud mngukonsoolid3
laste riided3
riided laste3
laste spordi-3
srgid laste3
mngukonsoolid ja3
televiisorid seinakinnitused3
ja lakid3
saapad ja3
tapeedid ja3
ja kleebised3
uksed aknad3
aknad ja3
ja trepid3
telerid ja3
mngukonsoolid telerid3
o p3
ja poolsaapad3
meeste saapad3
ja nutitelefonide3
telefonid nutikellad3
mobiiltelefonide ja3
nutikellad kevrud3
mobiiltelefonid nutitelefonid3
operatiivmlu ram3
retuusid lhikesed3
lhikesed ja3
ja pikad3
pikad pksid3
multimeedia mngijad3
vabaajajalatsid meeste3
ps4 mngud3
4 ps43
laste jalanud3
laste vabaajajalatsid3
laste basseini-3
basseini- ja3
ja rannasussid3
meeste jalanud3
kvakettad ssd3
tarvikud ilu3
ja paigaldustarvikud3
spordikaamerad spordikaamerate3
nukud ja3
lego lauamngud3
nohooldustooted naiste3
parfmid naiste3
optika foto3
foto spordikaamerad3
spordikaamerad binoklid3
spordikaamerate tarvikud3
lego mnguasjad3
kotid statiivid3
filtrid ja3
ja varjukid3
varjukid objektiivid3
objektiivid ja3
ja vlklambid3
akud laadijad3
tarvikud ekraani3
mnguasjad nukud3
ja kevrud3
filmirullid jne3
jalgrattad ja3
meeste ilutooted3
tarvikud naiste3
naiste ilutooted3
tervise- ja3
ja hgieenitooted3
elektrilised hambaharjad3
mbel elutuba3
fitness jalgrattad3
jalgrataste varuosad3
spordikellad ja3
treening ja3
kotid jalanud3
jalanud ja3
ja riietus3
riietus spordikellad3
spordikellad kevrud3
kevrud ja3
ja droonid3
kaitsekiled filmirullid3
ja muu3
isolatsiooni ja3
paadid ja3
turismiriietus ja3
ja -jalatsid3
seljakotid reisimiseks3
reisimiseks ja3
ja muuks3
ja turismijalatsid3
jalatsite tarvikud3
navigatsiooniseadmed ja3
ja kalapk3
turism ja3
hiired klaviatuurid3
ja tarkvara3
tervis meeste3
ja ups-id3
personaalarvutid ja3
slearvutid ja3
juhtmega vrgutooted3
juhtmevaba vrk3
ja reisimine3
turismitooted turism3
motokaubad rehvid3
pesumasinad front3
autoosad ja3
gps video3
video ja3
ja audio3
autokeemia ja3
ja puhastusvahendid3
lid ja3
ja mrdeained3
suur kodutehnika3
vlised kvakettad3
vike kodutehnika3
kodutehnika vike3
juhtmed ja3
kaablid juhtmed3
tv tooted3
korvid karbid3
karbid ja3
ja kastid3
vlisseadmed ja3
ja385
tarvikud104
naiste56
meeste50
laste28
kik25
muud23
vaata20
parfmid20
veel19
kodutehnika16
tooted16
lisatarvikud16
fitness16
jne15
mngukonsoolid14
akud14
kvakettad12
kingad12
jalanud12
koertele12
triistad11
ksitriistad11
vike11
adapterid11
riided11
tahvelarvutid11
pksid11
pood11
juuksehooldustooted11
video11
tv11
santehnika10
kassidele10
kosmeetika10
kotid10
lastele10
apple10
telefonid9
audio9
puhastusvahendid9
peokaubad9
srgid9
mnguasjad9
vrgutooted9
matka-9
kevrud9
kosmeetikatooted9
juhtmevabad9
lauamngud8
kgitehnika8
fototehnika8
kekellad8
sport8
arvutikomponendid8
kaladele8
puurid8
seadmed8
nud8
kodu8
puldid8
kaablid8
nohooldustooted8
muu7
vlisvalgustid7
led7
juhtmed7
kehahooldustooted7
mngijad7
laadijad7
lhikesed7
operatiivmlu7
spordi-7
vabaajajalatsid7
mbrised7
pistikud7
pallid6
ilu6
vikeloomade6
toit6
klaasid6
vrkpalli6
tervis6
integreeritavad6
ilutooted6
optika6
mhkmed6
sandaalid6
kaitsmed6
majapidamistooted6
kerised6
imikutele6
loomatarbed6
spordikaamerad6
lego6
kaitsekiled6
ekraani6
statiivid6
remont6
naistele6
aed6
auto-6
aksessuaarid6
motokaubad6
uksed6
ssd6
jalgrattad6
nutikellad6
arvutitehnika6
brootarbed6
slearvutid6
pirnid6
spordikellad6
spordijalatsid6
pannid6
vannituppa6
krvaklapid6
ktteseadmed6
valgustid6
mbel6
usb6
paadid6
turismitooted6
puhastustarvikud5
droonid5
gps5
lambid5
vlklambid5
jalgrataste5
objektiivid5
mrdeained5
hambaharjad5
navigatsiooniseadmed5
nukud5
filtrid5
hdd5
lakid5
akulaadijad5
personaalarvutid5
klaviatuurid5
toolid5
korpused5
monitorid5
tarkvara5
viimistlus-5
kleebised5
kruvikeerajad5
elektritriistad5
ehitusmaterjalid5
vrvid5
aeda5
klarid5
aknad5
kingitused5
varjukid5
elektrilised5
vrgutoodete5
ahjud5
mngud5
jahutus5
patareid5
jakid4
turismidemprid4
turismipksid4
turismiriided4
spordiriided4
tassid4
puhkuseks4
vestid4
spordirivad4
demprid4
knlad4
karnevali4
kostmid4
hupallid4
knlajalad4
pprice4
loe4
mototarvikud4
valgusllitid4
kgi-4
likekettad4
aias4
aiatmasinad4
kuivtoit4
konservid4
kanalisatsioon4
maiustused4
isolatsioon4
vikeloomadele4
roomajatele4
saunad4
veevarustuse4
ktte-4
kliimaseadmed4
remondiks4
sgitarbed4
sisevalgustus4
mgironimise4
svistatavad4
aiavalgustid4
interjr4
dormeo4
katlakivieemaldusvahendid4
puhastus-4
baaritarvikud4
pistikupesad4
kodus4
julutuled4
hekordsed4
majapidamistarvikud4
rohkem4
vabahumngud4
klmikud4
meestele4
mlukaardid4
kohvimasinad4
kgikombainid4
mikserid4
lauagrillid4
rsterid4
kinkekomplektid4
kummutid4
madratsid4
duigeel4
integreeritav4
tahvelarvutite4
ipad4
macbook4
no-4
keha-4
solaariumikreemid4
slearvutite4
serverid4
toiteplokid4
radiaatorid4
sgavklmikud4
kohviveskid4
batuudid4
hupuhastajad4
lindid4
fotopaber4
projektorid4
lutid4
imetamine4
kontoritoolid4
kleebisprinteri4
turvalisus4
potid4
autositudeks4
printerid4
jalutuskikudeks4
garantii4
vrkpall4
mhkimine4
jalgpalli4
ruuterid3
vlised3
juhtmega3
energiasstlikud3
ribad3
materjalid3
freespingid3
ups-id3
hiired3
elektri3
akutrellid3
vlisseadmed3
ning3
triistakomplektid3
mikrofonid3
arvutiklarid3
elektriinstallatsiooni3
retuusid3
lambipesad3
seinakinnitused3
tapeet3
videotehnika3
audiotehnika3
trepid3
ps43
03
playstation3
televiisorid3
plaadid3
telerid3
sprade3
type3
o3
p3
et3
pcompareatprice3
informatsioon3
tapeedid3
multimeedia3
vrk3
komponendid3
juhtmevaba3
ram3
korpus3
videokaardid3
emaplaadid3
abrasiivid3
protsessorid3
pikad3
e-lugerid3
mobiiltelefonid3
basseini-3
rannasussid3
saapad3
poolsaapad3
tagakaaned3
nutitelefonide3
mobiiltelefonide3
nutitelefonid3
terad3
spordikaamerate3
tellingud3
korvid3
esik3
lastetuba3
kontorimbel3
komplektid3
kgikomplektid3
kk3
karbid3
treening3
kastid3
kellad3
turism3
reisimine3
telgid3
magamiskotid3
varuosad3
trenarid3
-jalatsid3
autolambid3
binoklid3
filmirullid3
foto3
rehvid3
suverehvid3
autoosad3
videoregistraatorid3
erinevad3
autokeemia3
lid3
motoriietus3
rulluisud3
riietus3
espanderid3
turismiriietus3
seljakotid3
redelid3
kassiliiv3
taime-3
aiahooldustooted3
triietus3
jalatsid3
klmkapid3
peegelkaamerad3
aluspuru3
paigaldustarvikud3
front3
pesumasinad3
suur3
lindudele3
tolmuimejad3
rehad3
dyson3
isolatsiooni3
reisimiseks3
elutuba3
muuks3
turismijalatsid3
jalatsite3
voodid3
kalapk3
magamistuba3
ehted3
juukselikusmasinad3
kaalud3
hgieenitooted3
ventilaatorid3
tervise-3
fnid3
vannitoa3
habemeajamismasinad3
tarne3

Who hosts 1a.ee?

1a.ee Hosting Provider Information

Hosted IP Address:104.26.8.224
Hosted Hostname:104.26.8.224
Service Provider:TOT Public Company Limited
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "TOT Public Company Limited" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
TOT Public Company Limited
1.2305%

HTTP Header Analysis for 1a.ee

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 23 Mar 2021 22:00:42 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: max-age=0, private, must-revalidate
Vary: Accept
Strict-Transport-Security: max-age=63072000; includeSubDomains
Referrer-Policy: strict-origin-when-cross-origin
X-Permitted-Cross-Domain-Policies: none
X-XSS-Protection: 1; mode=block
X-Request-Id: 6fa30ca6-9aa2-42ea-aab3-ba2b53131922
Link:; rel=preload; as=style; nopush,; rel=preload; as=script; nopush
X-Download-Options: noopen
X-Frame-Options: SAMEORIGIN
X-Runtime: 0.065481
X-Content-Type-Options: nosniff
X-Powered-By: Phusion Passenger Enterprise 6.0.4
X-Backend: es_app_10
Age: 0
X-Cache: MISS
CF-Cache-Status: DYNAMIC
cf-request-id: 0902b3c8ca0000546429a39000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Report-To: {"group":"cf-nel","endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?s=CYVlZKPT0IOJ52FBGaRx8MgsCr4pj5Ua4SnqdTWRMH6mw1QLPBas7CUB9AWxVNxIevNX5S38eHQ2Ux/r7jjmm1UDH/Rx5FHIxa4="}],"max_age":604800}
NEL: {"max_age":604800,"report_to":"cf-nel"}
Server: cloudflare
CF-RAY: 634aef214b3d5464-LHR
Content-Encoding: gzip

1a.ee Domain Nameserver Information

HostIP AddressCountry
ines.ns.cloudflare.com 108.162.192.164
dan.ns.cloudflare.com 172.64.33.108


Need to find out who hosts 1a.ee?


Domain Registration (WhoIs) information for 1a.ee

 Search results may not be used for commercial, advertising, recompilation,
repackaging, redistribution, reuse, obscuring or other similar activities.

Estonia .ee Top Level Domain WHOIS server

Domain:
name: 1a.ee
status: ok (paid and in zone)
registered: 2010-07-04 06:26:04 +03:00
changed: 2020-11-11 01:33:43 +02:00
expire: 2021-11-19
outzone:
delete:

Registrant:
name: 1A.EE OÜ
org id: 11786222
country: EE
email: Not Disclosed - Visit www.internet.ee for webbased WHOIS
changed: 2020-11-11 01:33:43 +02:00

Administrative contact:
name: Not Disclosed - Visit www.internet.ee for webbased WHOIS
email: Not Disclosed - Visit www.internet.ee for webbased WHOIS
changed: Not Disclosed - Visit www.internet.ee for webbased WHOIS

Technical contact:
name: Not Disclosed - Visit www.internet.ee for webbased WHOIS
email: Not Disclosed - Visit www.internet.ee for webbased WHOIS
changed: Not Disclosed - Visit www.internet.ee for webbased WHOIS

Registrar:
name: NETIM
url: http://www.netim.com/domain-name/ee-domain.html
phone:
changed: 2018-11-08 14:36:55 +02:00

Name servers:
nserver: dan.ns.cloudflare.com
nserver: ines.ns.cloudflare.com
changed: 2019-05-08 12:43:09 +03:00

Estonia .ee Top Level Domain WHOIS server
More information at http://internet.ee

Websites with Similar Names

1a-absperrtechnik.de
1A-Absperrtechnik | Ihr Fachshop für Betrieb, Industrie und Kommune | 1A-Absperrtechnik | Ihr Spezialist für Betrieb, Industrie und Kommune
1a-ads.de
Microjobs Easy Work From Home-Start Your Own job, Micro Job & PTC site with All in one MiniJob
1a-allesda.de
1a-allesda.de - Websiteerstellung, Hosting und Domains
1a-android.de
1a-android.de | Android News, Testberichte und mehr…
1a-angelshop.de
Onlineshop für Angelgerät Angelzubehör und Angelladen in Berlin - 1A-Angelshop
1a-anlasser.de
1a-anlasser
1a-anwaltsseminare.de
1a-AnwaltsSeminare.de - Ihr unabhängiger Seminarvermittler im deutschsprachigen Raum
1a-anzeigen.de
1a-Anzeigen.de
1a-apartment-berlin.de
1a-Apartment-Berlin.de
1a-auction.de
Test Page for the Nginx HTTP Server on EPEL

Recently Updated Websites

Keurkhadijafoundation.org (1 second ago.)Lintubank.com (1 second ago.)Yulebet3871.com (2 seconds ago.)Av-softball.com (2 seconds ago.)Makeitsimplemeals.com (2 seconds ago.)Yarland.ru (2 seconds ago.)Liaburton.com (3 seconds ago.)Rbxlop.xyz (3 seconds ago.)Testedsign.com (3 seconds ago.)Zktc.ch (4 seconds ago.)Donnachomes.com (4 seconds ago.)Emulative.org (4 seconds ago.)Taradawnauthor.us (4 seconds ago.)Thebestratedmattressdeals.website (4 seconds ago.)Giganorthamerica.com (4 seconds ago.)Q1hospitals.com (4 seconds ago.)Donovan-institute.org (4 seconds ago.)Gym-juice.online (5 seconds ago.)Showmymvp.com (5 seconds ago.)Xtrjoin.com (5 seconds ago.)Uglyhanukahsweater.com (5 seconds ago.)Trart.ru (6 seconds ago.)Thevalentine.agency (6 seconds ago.)Newnangoldandjewelry.com (6 seconds ago.)Nhu-y.com (7 seconds ago.)Sealsubscriptions.com (7 seconds ago.)Valentusweightlossdrinks.com (7 seconds ago.)Iipsj.org (7 seconds ago.)Gdsgroup.com (8 seconds ago.)Achtrk.com (8 seconds ago.)

Recently Searched Keywords

special topics (17 seconds ago.)public ministres collectivits (18 seconds ago.)rooh (42 seconds ago.)“thanh niên với tình bạn, tình yêu, gia đình và quyên góp ủng hộ đồng bào miền trung” tại trường thpt tân trào (44 seconds ago.)edge 12 (51 seconds ago.)windowperformancenow var ltime (59 seconds ago.)“thanh niên với tình bạn, tình yêu, gia đình và quyên góp ủng hộ đồng bào miền trung” tại trường thpt tân trào (1 minute 4 seconds ago.)more world gold coins (1 minute 5 seconds ago.)遮天 辰东 小说笔趣阁 (1 minute 16 seconds ago.)industry synonym (1 minute 33 seconds ago.)httpsschemaorg type (1 minute 41 seconds ago.)erp (1 minute 42 seconds ago.)33 33 (1 minute 45 seconds ago.)t- shirts (1 minute 48 seconds ago.)“thanh niên với tình bạn, tình yêu, gia đình và quyên góp ủng hộ đồng bào miền trung” tại trường thpt tân trào (1 minute 53 seconds ago.)turkey (1 minute 55 seconds ago.)bbnl customer care (2 minutes ago.)hair (2 minutes 2 seconds ago.)more than (2 minutes 4 seconds ago.)aller (2 minutes 8 seconds ago.)width 200px media (2 minutes 10 seconds ago.)err err (2 minutes 13 seconds ago.)electric stair lifts (2 minutes 14 seconds ago.)fee (2 minutes 15 seconds ago.)new ca0 (2 minutes 16 seconds ago.)north nj (2 minutes 19 seconds ago.)di boat (2 minutes 22 seconds ago.)もっと読む (2 minutes 26 seconds ago.)podcast-pr-lumetri_1.mp4 (2 minutes 27 seconds ago.)y web (2 minutes 31 seconds ago.)