1gb.ua Website Information

Website Ranks & Scores for 1gb.ua

Statvoo Rank Statvoo Rank:F
Alexa Rank Alexa Rank:304,480
Majestic Rank Majestic Rank:76,643
Domain Authority Domain Authority:52%
DMOZ DMOZ Listing:No

Whois information for 1gb.ua

Full Whois Lookup for 1gb.ua Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for 1gb.ua. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% request from 2a01:7e00::f03c:91ff:fe84:f734
% This is the Ukrainian Whois query server #B.
% The Whois is subject to Terms of use
% See https://hostmaster.ua/services/
%

domain: 1gb.ua
dom-public: NO
license: 70701
registrant: ua-ogb-6
admin-c: ua-ogb-5
tech-c: ua-ogb-5
mnt-by: ua.1gb
nserver: uns2.1gb.ru
nserver: ns1.1gb.com.ua
status: clientDeleteProhibited
status: clientTransferProhibited
created: 2011-09-07 00:22:15+03
modified: 2015-03-31 12:11:47+03
expires: 2025-01-01 18:54:38+02
source: UAEPP

% Registrar:
% ==========
registrar: ua.1gb
organization: LLC "1 GB"
organization-loc: ??? "1 ??"
url: http://www.1Gb.ua
city: Kyiv
country: UA
source: UAEPP

% Registrant:
% ===========
contact-id: ua-ogb-6
person: 1GB LLC
organization: 1GB LLC
e-mail: Login to show email
Kominterna 29 45
address: KIEV
postal-code: 01030
country: UA
country-loc: UA
phone: +380.443907159
fax: +380.442871813
mnt-by: ua.1gb
status: ok
status: linked
created: 2014-03-31 17:40:27+03
source: UAEPP

% Administrative Contacts:
% =======================
contact-id: ua-ogb-5
person: 1GB LLC
organization: 1GB LLC
e-mail: Login to show email
Kominterna 29 45
address: KIEV
postal-code: 01030
country: UA
country-loc: UA
phone: +380.443907159
fax: +380.442871813
mnt-by: ua.1gb
status: ok
status: linked
created: 2014-03-31 17:33:25+03
source: UAEPP

% Technical Contacts:
% ===================
contact-id: ua-ogb-5
person: 1GB LLC
organization: 1GB LLC
e-mail: Login to show email
Kominterna 29 45
address: KIEV
postal-code: 01030
country: UA
country-loc: UA
phone: +380.443907159
fax: +380.442871813
mnt-by: ua.1gb
status: ok
status: linked
created: 2014-03-31 17:33:25+03
source: UAEPP


% Query time: 31 msec

Who hosts 1gb.ua?

1gb.ua is hosted by 1GB LLC in Kyyiv, Kiev, Ukraine, 01030.
1gb.ua has an IP Address of 195.234.4.13 and a hostname of u1.1gb.ua.



1gb.ua Web Server Information

Hosted IP Address:195.234.4.13
Hosted Hostname:u1.1gb.ua
Service Provider:1GB LLC
Hosted Country:UkraineUA
Location Latitude:50.4547
Location Longitude:30.5238
Webserver Software:Not Applicable
Google Map of 50,12

HTTP Header Analysis for 1gb.ua

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 13 Jul 2015 03:38:05 GMT
Server: Microsoft-IIS/6.0
X-Powered-By: PHP/4.3.11
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-Type: text/html; charset=windows-1251
Content-Length: 142403


Need to find out who hosts 1gb.ua?

1gb.ua Free SEO Report

Website Inpage Analysis for 1gb.ua

H1 Headings:0
H2 Headings:4
Требуемый набор услуг
Также к вашим услугам:
Также к вашим услугам:
Также к вашим услугам:
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:55
Google Adsense:Not Applicable
Google Analytics:UA-25966792-1

Keyword Cloud for 1gb.ua

xvds hypervndefquotasliderndb1slider maxnone documentgetelementbyidlssd2styledisplay none0 nhvmemmax 300000if nprostonperiodreal 24nhvdskbif nquotapttt mathrounddocumentgetelementbyidlturbo3styledisplay none0 slidernquotadmnslidervalue4535 ndefturbo 0donevdsonslidernhvdskslidervaluedocumentgetelementbyidlturbo1styledisplay nonessl httpsif nhvcpunquota penddocumentgetelementbyidlturbo2styledisplay nonemin 0 if204728documentgetelementbyidllegal2styledisplayslidernhvdskdescinnerhtmldocumentgetelementbyidlhst10styledisplayminpturbo0 descdiv3635 ndefturbondbpvnone documentgetelementbyidlturbo1styledisplaymax 32desct desctminphvdskminpcpulimitmaxpad1 0 varnquota pend elseslidernhvdsksliderslidernquotadmnsliderdocumentgetelementbyidldmn2styledisplay nonenperiodreal 1descaddndefwpbelse ptttminpiiseconvalidateppdocumentgetelementbyidilegal2checked falsemathround ptt nperiodrealslidernturbodescinnerhtml0 desctptttnquotadb1 1000descdiv windowslinux pbegdescdiv windowslinuxnsites 0 nquotaserverblockfalseminif nquotassd 0var125 phmin 0nsites 0ph ncpunwpb 0slidernhvssdslidervalue18slidernhvdskbslidervaluevalue 00 documentgetelementbyidiprostocheckedpendpbeg nquotadb1nprosto 1nhvcpu 0slidernvdsslidervalue 0if nprosto 1nquotadb1descdivoldnplan 040311 else0 slidernhvdskslidervaluefalse documentgetelementbyidiprostoxcheckeddocumentgetelementbyidlhst8styledisplayslidernipslidervalueif nquotadb1 014ncpu 0if nquotadb1 1000if ptt 0if nplandocumentgetelementbyidlhst4styledisplaydocumentgetelementbyidlssd1styledisplay nonedocumentgetelementbyidlhst1styledisplay none documentgetelementbyidlhst2styledisplay48nquotadmn 0descdivnone documentgetelementbyidlturbo3styledisplay noneslidernwpbslidervaluenquotadb1 ifpmult 08 085documentgetelementbyidlhst3styledisplaydocumentgetelementbyidlexthstyledisplay none documentgetelementbyidlturbo1styledisplaye52695v2 240mdet 1windowslinux pbeg nquotadocumentgetelementbyidlssd2styledisplayslidernturboslidervalue 0 slidernquotassdslidervalue3ruelse if nquotadb1documentgetelementbyidlhst11styledisplaylnkhvbackuphelpdescinnerhtml240 ghz30ptttold pttt documentgetelementbyidnprostodocumentgetelementbyidldb1styledisplayif ptt25slidernquotassdslidervalue 0 slidernquotadmnslidervaluenhvcpuslidernplansliderlnkallslidernvdsslider max461 desctif 0if ncpunhvdsk 0if nturboe52695v2 240 ghzif nvds 0slidernhvdskslidervalue 0if nlegalvds else documentgetelementbyidvds elseslidernhvcpuslidervaluenperiodrealnip ifnone documentgetelementbyidlexthstyledisplay none24px iflnksuffixccua22pmultnsitesnone documentgetelementbyidlturbo3styledisplaydocumentgetelementbyidldmn1styledisplay noneslidernhvdskbslidervalue 0ptt0 slidernvdsslidervalueslidernsitesslider max0 nquotamaxhdd08 085ssdq0 varnsites iflimext 1if nquotadb1nturbo 0ndefquotadmn 0documentgetelementbyidlssd2styledisplay nonepmult 08mysql1 ifslidernsitesslidervalue16documentgetelementbyidlturbo2styledisplaynvds 1ssdmysql 5085slidernvdsslider085 085if ndomainsalesenvdsminphvcntslidernquotadb1slider0 nquotadb1vds openvzdocumentgetelementbyidsw2stylebackgroundffffff0 nsitesdocumentgetelementbyidsw1stylebackgroundffffff0 documentgetelementbyidhypervnipmathroundhyperv vdsif ph0 phdocumentgetelementbyidiprostochecked false documentgetelementbyidiprostoxcheckedelsepend elsepbeg nquotaerrors vds if1gbuadocumentgetelementbyid slidernturbodescinnerhtml11windowslinux pbegdocumentgetelementbyidlturbo1styledisplayslidernperiodslidervaluedocumentgetelementbyid slidernhvcpudescinnerhtml0 slidernhvdskslidervalue 0pv ph51documentgetelementbyidiprostoxchecked falseif nperiodreal27httpsdesct mysql 5mathround pttltdua infuanquotaoldnbspnbsp nbspnbspnwpbxeon e52695v2 2401 descdivpttt mathround pttpbeg0 ndefquotassd 00 slidernhvmemslidervalueph 125documentgetelementbyidssd if0 documentgetelementbyidiprostochecked falsewdntrue elsemicrosoft sqlndefquotassd 0 ndefquotadmn440 nhvdskbanimateminpwpb6 ptttslidernquotassdslidernperiodreal 6n 300 slidernipslidervalueminphvcpuptttold ptttndefcpuif nperiodreal 6documentgetelementbyidiprostocheckedinnerxmif 1 desctslidernipslidervalue 0postgresnone documentgetelementbyidldmn2styledisplaynone documentgetelementbyidldmn2styledisplay noneif enhst0 ifdocumentgetelementbyidlexthstyledisplay noneenhstslidernhvmemslidervalue 01 0continuepronalog1ndesct mysqlnvalidatetimer32nlegal2pend ifslidernquotassdslider maxnhvdsk0 slidernhvdskbslidervalue 0minpssdif n 30sliderncpusliderx 2000documentgetelementbyidlhst2styledisplay0 nhvdsknquota6 if24if nquotadmn 0slidernhvmemdescinnerhtmlifslidernquotadmnslider maxnperiodreal 6 pttt23documentgetelementbyidlhst7styledisplaynone documentgetelementbyidlwpb1styledisplay24pxslidernhvdskbsliderif nhvmempttt ptt pronalogdocumentgetelementbyidplannameinnerhtml if nplandesctpend else descdivfalse ifnperiodreal 480 ndefquotassdcontinue ifnhvdsk ifslidernquotadmnslidervalue49slidernhvcpusliderdocumentgetelementbyidldmn1styledisplay none documentgetelementbyidldmn2styledisplayncdnnone documentgetelementbyidlturbo1styledisplay nonenhvssdptttolddocumentgetelementbyidimdetchecked5if nprostoxpxncpunewbalancetext15 if0 slidernhvmemslidervalue 0if nquotassdmaxwidthpttt pttt0 if limextnplanoldnone documentgetelementbyidlexthstyledisplay50v documentgetelementbyid3 ifdesct if290 slidernhvssdslidervalueif nperiodnperiodreal 3pttt documentgetelementbyid0 pvvds if37documentgetelementbyidprostodescstyledisplayreturnsliderndb1slidernperiodreal ifphtif documentgetelementbyidif nsitesif limext 139parallelsfalse documentgetelementbyidiprostoxchecked falseif nhvdskdocumentgetelementbyidlwpb2styledisplayslidernquotaslideradjustpagewidthelse documentgetelementbyidnprosto 1 descdivsettimeout nvalidateif nslidernhvssdslidernbsp nbspe52695v2documentgetelementbyididbc1checked2 phnprosto 1 desctsqldocumentgetelementbyidmvdscheckedxlimmemoslidernquotaslidervalue62none documentgetelementbyidlhst2styledisplaydocumentgetelementbyidplannameinnerhtmldesct phpdocumentgetelementbyidldmn2styledisplay19ndefturbo 0 ndefquotassddocumentgetelementbyidlexthstyledisplay0 elseslidernhvdskslider maxdocumentgetelementbyid slidernhvdskdescinnerhtmldocumentgetelementbyidlmst4styledisplaypbegpminphvipdocumentgetelementbyidiprostoxcheckeddocumentgetelementbyidhostpricespanrowspandocumentgetelementbyidilegal2checked false ifdocumentgetelementbyidlturbo3styledisplaynone documentgetelementbyidldb1styledisplayerrors vdsnlegalnquotadb1oldslidernhvmemslider maxslidernhvdskbslider maxmax 800021if nperiodreal 1pend else ifminphvdskbipslidernperiodsliderif nquotadmnslidernturboslider maxdocumentgetelementbyidplannameinnerhtml if41minpdiskdb085 econone documentgetelementbyidldmn1styledisplay nonendefcpu 35false documentgetelementbyidplannameinnerhtmlif nlegal2slidernturboslidervaluedocumentgetelementbyidbl2styledisplaynone00 ndefquotadmn 0vnquotadmnnvds iftarnperiod0840 ndefquotadmnnvds 0px if0 slidernhvcpuslidervalueslidernhvcpudescinnerhtmlpend ramprosto1gbuandomainsalesdocumentgetelementbyidilegal2checkedmicrosoftvdsslidernquotassdslidervalue 0slidernhvmemslidervaluedocumentgetelementbyidlhst1styledisplay nonedocumentgetelementbyidldb1styledisplay none documentgetelementbyidlexthstyledisplaynquotadb1 0support1gbuanperiodreal 60pbeg nquotadb1 pendsliderncpuslidervalue33true0 continuendefturbo 0ntoldpok desctdocumentgetelementbyidbl3styledisplaynonenquota ifminphvdskb 0if nwpbelse descdivnonexeon e52695v2openvzaddslidernturbosliderdocumentgetelementbyidldb1styledisplay none4326nperiodreal if documentgetelementbyidpttt pttnone documentgetelementbyidlturbo2styledisplayptt 0documentgetelementbyidilegalcheckedpbeg nquota pendghzstep 11 varif newpad0 slidernquotadmnslidervalue 0pend descaddnqdesc13slidernhvdskslidervalue 0 slidernhvdskbslidervalueif nwpb 0none documentgetelementbyidldmn1styledisplaynsites continueminphvmeminfua4215nlegal2 0continue if nvdsph 0if 178ph nsitesdocumentgetelementbyidldmn1styledisplaynbsp0 134else desctif nsites 0ndefperiodnperiodreal 12documentgetelementbyidiprostochecked false documentgetelementbyidplannameinnerhtmldocumentgetelementbyidlssd1styledisplay none documentgetelementbyidlssd2styledisplayfalse documentgetelementbyidplannameinnerhtml ifwindowslinuxif limextdocumentgetelementbyidlwpb1styledisplaynhvmempttt ifpend desctdescdiv ifwindows serverslidernvdsslidervaluepokif nhvssdsettimeoutsslnbspnbspnbspnquota 0max 20stepslidernquotadb1slidervalueif ph 0minpdisk0 nquotassd0 slidernhvdskbslidervalueslidernhvcpuslidervalue 0minphvssdndefquotassdnsitesoldlinuxdocumentgetelementbyidlhst5styledisplaydocumentgetelementbyidsw3stylebackgroundffffffflashcacheerrorsdocumentgetelementbyidbl1styledisplaynoneptmovingdescdiv descdivnprostoxslidernquotadb1slider maxdescdiv else12nquotadb1 pend elseerrors ifminpemail0 slidernwpbslidervalue35documentgetelementbyidlmst4xstyledisplayif nperiodreal 30 slidernquotaslidervaluedocumentgetelementbyidlssd1styledisplay0 functionnvdsdocumentgetelementbyidiprostochecked falsendefturbonone documentgetelementbyidlssd2styledisplayph0 continue ifptt pronalogif nipmdetdnsmax 40024px if documentgetelementbyidpvtpv 0nqdescolddocumentgetelementbyid hvbackuphelpdescinnerhtmldocumentgetelementbyidlhst9styledisplaydocumentgetelementbyidlturbo1styledisplay none documentgetelementbyidlturbo2styledisplay0 slidernturboslidervalueif nvdsnquotadb1 pendslidernipslider maxnquotassd 0else ifnhvdskb 0nperiodreal 36descdiv pbeg1 vdsdocumentgetelementbyidlhst1styledisplayndefquotadmnslidernhvmemslidernone documentgetelementbyidlturbo2styledisplay nonencpu ifnquotassdv vif nturbo 0animate fastmax 300if nvds 117pttt pttt ptttlimextdonedocumentgetelementbyidldmn2styledisplay none documentgetelementbyidldb1styledisplayslidernhvcpuslider maxnhvmem 0buylinkphpslidernsitesslidernewwidthntdocumentgetelementbyidlmdetstyledisplay0 slidernhvcpuslidervalue 00 nquota 0documentbodyoffsetwidthwindowsnvdsoldfunctionslidernquotassdslidervaluenbspnbspslidernwpbslidervds else ifnone documentgetelementbyidldb1styledisplay nonefastslidernquotaslider maxslidernturboslidervalue 0documentgetelementbyidlturbo2styledisplay none documentgetelementbyidlturbo3styledisplayndefquotadmn 0 documentgetelementbyidiprostocheckednsites 20 slidernquotassdslidervaluedocumentgetelementbyidlhst6styledisplay9slidernquotadmnslidervalue 0ndefsitesndefquotassd 0ndefquotadb1ram1 else if38vipnewpaddisablednbsp nbsp nbspptt nperiodreal1 if 0ndefcpu 35 ndefturboltduadocumentgetelementbyid slidernhvmemdescinnerhtmlactualbalancefloatnturbovalue0 lnk10limextnplanstep 10documentgetelementbyidlssd2styledisplay none documentgetelementbyidldmn1styledisplayxeondesct desct desctslidernipsliderdesctxssd flashcacheenvds false

Longtail Keyword Density for 1gb.ua

KeywordsOccurences
if limext 114
0 if limext13
min 0 if13
ndefturbo 0 ndefquotassd11
documentgetelementbyidplannameinnerhtml if nplan10
pttt ptt pronalog9
if nsites 09
false documentgetelementbyidplannameinnerhtml if9
if nprosto 18
ndefquotassd 0 ndefquotadmn8
0 ndefquotadmn 08
ndefquotadmn 0 documentgetelementbyidiprostochecked8
documentgetelementbyidiprostochecked false documentgetelementbyidplannameinnerhtml8
0 ndefquotassd 08
0 documentgetelementbyidiprostochecked false6
pend else if5
pbeg nquota pend5
if nperiodreal 65
pbeg nquotadb1 pend5
pttt pttt pttt5
e5-2695v2 240 ghz5
xeon e5-2695v2 2405
nsites 0 nquota4
1 0 var4
if nquotadb1 10004
none documentgetelementbyidlturbo2styledisplay none4
documentgetelementbyidlturbo2styledisplay none documentgetelementbyidlturbo3styledisplay4
none documentgetelementbyidlturbo3styledisplay none4
if nvds 14
if nperiodreal 34
desct mysql 54
nprosto 1 desct4
nquota pend else4
errors vds if4
if ph 04
documentgetelementbyidlturbo1styledisplay none documentgetelementbyidlturbo2styledisplay4
nquotadb1 pend else4
false documentgetelementbyidiprostoxchecked false4
if nturbo 04
0 continue if4
continue if nvds4
if nvds 04
0 nquota 04
windowslinux pbeg nquota3
pend else descdiv3
descdiv windowslinux pbeg3
nprosto 1 descdiv3
mathround ptt nperiodreal3
documentgetelementbyidiprostochecked false documentgetelementbyidiprostoxchecked3
nperiodreal 6 pttt3
pttt mathround ptt3
0 slidernhvdskbslidervalue 03
ptttold pttt documentgetelementbyid3
else if nquotadb13
0 slidernhvmemslidervalue 03
if 1 desct3
0 slidernhvcpuslidervalue 03
desct desct desct3
24px if documentgetelementbyid3
if nwpb 03
if nquotadmn 03
0 slidernhvdskslidervalue 03
0 slidernquotadmnslidervalue 03
if nquotadb1 03
if nquotassd 03
slidernhvdskslidervalue 0 slidernhvdskbslidervalue3
if ptt 03
slidernturboslidervalue 0 slidernquotassdslidervalue3
nbsp nbsp nbsp3
none documentgetelementbyidldb1styledisplay none3
documentgetelementbyidldmn2styledisplay none documentgetelementbyidldb1styledisplay3
none documentgetelementbyidldmn2styledisplay none3
slidernquotassdslidervalue 0 slidernquotadmnslidervalue3
1 if 03
none documentgetelementbyidlexthstyledisplay none3
documentgetelementbyidlexthstyledisplay none documentgetelementbyidlturbo1styledisplay3
documentgetelementbyidldb1styledisplay none documentgetelementbyidlexthstyledisplay3
documentgetelementbyidlhst1styledisplay none documentgetelementbyidlhst2styledisplay3
1 else if3
documentgetelementbyidilegal2checked false if3
if n 303
documentgetelementbyidlssd2styledisplay none documentgetelementbyidldmn1styledisplay3
if nperiodreal 13
none documentgetelementbyidlssd2styledisplay none3
pmult 08 0853
documentgetelementbyidlssd1styledisplay none documentgetelementbyidlssd2styledisplay3
none documentgetelementbyidldmn1styledisplay none3
vds else documentgetelementbyid3
ndefcpu 35 ndefturbo3
documentgetelementbyidldmn1styledisplay none documentgetelementbyidldmn2styledisplay3
35 ndefturbo 03
nperiodreal if documentgetelementbyid3
vds else if3
none documentgetelementbyidlturbo1styledisplay none3
0 var44
if documentgetelementbyid37
0 if25
if nperiodreal23
else if21
continue if20
0 lnk20
if nsites18
animate fast18
min 018
if n18
limext 115
value 015
if limext14
if nvds14
if nplan13
1 if12
nsites 012
ndefturbo 012
settimeout nvalidate11
0 ndefquotassd11
documentgetelementbyidiprostochecked false11
if ndomainsales10
if nprosto10
0 descdiv10
false documentgetelementbyidplannameinnerhtml10
documentgetelementbyidplannameinnerhtml if10
ptt pronalog9
ndefquotassd 09
ndefquotadmn 09
if nperiod9
pttt ptt9
1 descdiv8
pend else8
if 18
false if8
0 ndefquotadmn8
0 documentgetelementbyidiprostochecked8
vds if8
1 desct8
nprosto 18
if nquotadb18
nquota 07
if nturbo7
vds hyper-v7
0 nquota7
pend if7
nvds 07
step 17
desct desct6
vds else6
nperiodreal 66
documentgetelementbyid slidernhvmemdescinnerhtml6
if nwpb6
pttt pttt6
documentgetelementbyid slidernhvdskdescinnerhtml6
nquotadb1 10006
nquotadb1 06
nquotadb1 pend6
nquota pend6
nperiodreal if6
errors if6
if enhst5
pbeg nquotadb15
pbeg nquota5
nperiodreal 35
nsites if5
else descdiv5
if nquota5
if nquotassd5
descdiv if5
if nhvdsk5
nquotassd 05
if nhvmem5
xeon e5-2695v25
errors vds5
if ncpu5
pok desct5
e5-2695v2 2405
documentgetelementbyidiprostoxchecked false5
nbsp-nbsp nbsp-nbsp5
ssd flashcache5
240 ghz5
else documentgetelementbyid5
if 05
else desct5
nturbo 05
nbsp nbsp5
pttt if4
documentgetelementbyidlturbo1styledisplay none4
none documentgetelementbyidlturbo2styledisplay4
pmult 084
if ph4
mathround ptt4
else pttt4
documentgetelementbyid hvbackuphelpdescinnerhtml4
documentgetelementbyid slidernhvcpudescinnerhtml4
0 nhvdskb4
ph 04
nlegal2 04
if nprostox4
nquota if4
documentgetelementbyidlhst1styledisplay none4
documentgetelementbyidlturbo3styledisplay none4
documentgetelementbyidlturbo2styledisplay none4
v documentgetelementbyid4
if nquotadmn4
none documentgetelementbyidlturbo3styledisplay4
125 ph4
nquotadb1 if4
0 slidernquotadmnslidervalue4
nquotadmn 04
0 slidernquotassdslidervalue4
ncpu 04
nhvdsk 04
0 slidernhvdskslidervalue4
pend descadd4
0 slidernhvdskbslidervalue4
pend desct4
nplan 04
0 desct4
max 3004
false documentgetelementbyidiprostoxchecked4
1 var4
hyper-v vds4
max 3000004
desct mysql4
mysql 54
max 80004
0 slidernhvcpuslidervalue4
0 slidernhvmemslidervalue4
nperiodreal 14
3 if4
true else4
slidernhvdskslidervalue 04
nvds 14
ptttold pttt4
0 continue4
0 nquotadb14
1 04
nwpb 04
2 ph3
nsites 23
0 ph3
descdiv descdiv3
v v3
pv 03
pttt mathround3
if newpad3
px if3
24px if3
ptt nperiodreal3
x 20003
0 pv3
ph nsites3
pttt documentgetelementbyid3
documentgetelementbyid slidernturbodescinnerhtml3
windows server3
desct php3
if nlegal3
if ptt3
ptt 03
pv ph3
descdiv else3
085 0853
085 eco3
08 0853
6 pttt3
desct if3
pend ram3
ssl https3
microsoft sql3
descdiv windowslinux3
ph ncpu3
descdiv pbeg3
windowslinux pbeg3
15 if3
ph 1253
none documentgetelementbyidldmn1styledisplay3
nhvmem 03
nhvdskb 03
0 slidernhvssdslidervalue3
nhvcpu 03
0 slidernipslidervalue3
0 slidernquotaslidervalue3
slidernvdsslider max3
slidernturboslider max3
documentgetelementbyidilegal2checked false3
0 slidernvdsslidervalue3
0 slidernturboslidervalue3
nperiodreal 483
nperiodreal 603
ssd if3
nperiodreal 363
nperiodreal 243
0 slidernwpbslidervalue3
6 if3
nperiodreal 123
max 323
slidernhvcpuslider max3
n 303
slidernsitesslider max3
max 203
sliderndb1slider max3
0 function3
minphvdskb 03
vds openvz3
1 vds3
ltdua infua3
slidernquotaslider max3
slidernquotadb1slider max3
max 4003
step 103
slidernhvdskbslider max3
slidernhvdskslider max3
slidernhvmemslider max3
slidernquotassdslider max3
slidernquotadmnslider max3
slidernipslider max3
slidernturboslidervalue 03
slidernquotassdslidervalue 03
none documentgetelementbyidlturbo1styledisplay3
envds false3
none documentgetelementbyidlhst2styledisplay3
none documentgetelementbyidlwpb1styledisplay3
documentgetelementbyidlexthstyledisplay none3
none documentgetelementbyidlexthstyledisplay3
documentgetelementbyidldmn2styledisplay none3
none documentgetelementbyidldb1styledisplay3
documentgetelementbyidldb1styledisplay none3
1 else3
0 13
ncpu if3
nip if3
nvds if3
if nhvcpu3
if nip3
ndefcpu 353
35 ndefturbo3
if nlegal23
none documentgetelementbyidldmn2styledisplay3
documentgetelementbyidldmn1styledisplay none3
slidernhvmemslidervalue 03
slidernhvdskbslidervalue 03
nhvdsk if3
slidernhvcpuslidervalue 03
slidernipslidervalue 03
slidernquotadmnslidervalue 03
0 nhvmem3
0 nhvdsk3
slidernvdsslidervalue 03
0 else3
documentgetelementbyidlssd1styledisplay none3
none documentgetelementbyidlssd2styledisplay3
documentgetelementbyidlssd2styledisplay none3
mdet 13
nsites continue3
if nhvssd3
0 nsites3
0 nquotassd3
0 documentgetelementbyid3
if333
0300
var121
1106
else94
documentgetelementbyid93
none93
max44
nperiodreal41
nsites41
ph41
desct40
vds38
descdiv38
pttt32
nvds32
pend32
false31
n30
nquota29
pbeg28
nquotadb127
nbsp27
continue25
lnk25
225
ptt24
errors23
ssd22
lnkall22
nhvdsk21
nplan21
320
nhvmem19
ncpu18
nturbo18
animate18
418
min18
fast18
limext17
value17
nwpb16
step16
nquotassd16
nhvcpu16
516
function16
616
pp15
715
nip15
815
settimeout15
true15
ndefquotadb114
ndefquota14
ndefcpu14
ndefquotadmn14
ndefquotassd14
return14
ndefsites14
ndefturbo14
nvalidate14
nprosto14
documentgetelementbyidiprostochecked14
pv14
v13
nhvdskb13
913
pmult12
ram12
hyper-v12
1012
nquotadmn12
mathround11
ndomainsales11
1111
windows11
nhvssd11
pronalog11
documentgetelementbyidplannameinnerhtml11
nperiod10
pok10
eco10
slidernvdsslidervalue10
1210
1310
mysql10
nlegal29
149
nbsp-nbsp9
slidernhvdskbslider8
newpad8
slidernhvcpuslider8
slidernvdsslider8
enhst8
slidernturboslider8
1gbua8
slidernhvdskslider8
linux8
slidernquotadmnslider8
slidernquotassdslider8
slidernquotadb1slider8
slidernquotaslider8
slidernipslider8
pt8
sliderndb1slider8
slidernhvmemslider8
slidernquotassdslidervalue7
xeon7
pvt7
157
167
pht7
slidernsitesslider7
documentgetelementbyididbc1checked7
nprostox7
177
documentgetelementbyidiprostoxchecked7
slidernsitesslidervalue6
ip6
186
slidernwpbslidervalue6
slidernhvdskslidervalue6
openvz6
slidernturboslidervalue6
newwidth6
nlegal6
documentbodyoffsetwidth6
https6
slidernhvssdslider6
nqdesc6
slidernperiodslider6
slidernwpbslider6
documentgetelementbyidlhst1styledisplay6
slidernhvdskdescinnerhtml6
slidernhvmemdescinnerhtml6
0856
196
206
descadd6
sliderncpuslider6
add6
envds6
216
postgres6
documentgetelementbyidlturbo1styledisplay5
documentgetelementbyidlturbo2styledisplay5
documentgetelementbyidlturbo3styledisplay5
php5
mdet5
e5-2695v25
225
235
pbegp5
support1gbua5
245
flashcache5
ghz5
desctx5
server5
255
microsoft5
slidernhvmemslidervalue5
265
slidernplanslider5
275
documentgetelementbyidilegal2checked5
285
295
nsitesold5
prosto1gbua5
305
ndb5
ptttold5
slidernquotadmnslidervalue5
slidernhvcpuslidervalue5
minphvdskb5
nplanold5
slidernipslidervalue5
slidernquotaslidervalue5
314
documentgetelementbyidlhst10styledisplay4
324
334
xlimmemo4
344
documentgetelementbyidlhst11styledisplay4
documentgetelementbyidlwpb2styledisplay4
newbalancetext4
documentgetelementbyidlmdetstyledisplay4
nbspnbsp4
documentgetelementbyidlwpb1styledisplay4
lnksuffix4
354
364
wdn4
documentgetelementbyidmvdschecked4
084
documentgetelementbyidlhst9styledisplay4
actualbalancefloat4
374
vip4
slidernhvcpudescinnerhtml4
hvbackuphelpdescinnerhtml4
parallels4
384
disabled4
documentgetelementbyidlhst8styledisplay4
documentgetelementbyidlssd1styledisplay4
moving4
documentgetelementbyidldmn1styledisplay4
documentgetelementbyidldmn2styledisplay4
documentgetelementbyidlexthstyledisplay4
documentgetelementbyidldb1styledisplay4
maxwidth4
ssdq4
24px4
slidernhvdskbslidervalue4
slidernhvssdslidervalue4
slidernquotadb1slidervalue4
documentgetelementbyidilegalchecked4
nt4
adjustpagewidth4
documentgetelementbyidprostodescstyledisplay4
documentgetelementbyidlssd2styledisplay4
documentgetelementbyidlhst2styledisplay4
documentgetelementbyidlhst6styledisplay4
documentgetelementbyidlhst5styledisplay4
nvdsold4
documentgetelementbyidlhst7styledisplay4
documentgetelementbyidhostpricespanrowspan4
documentgetelementbyidlhst3styledisplay4
documentgetelementbyidlhst4styledisplay4
minpdiskdb3
sql3
documentgetelementbyidsw2stylebackgroundffffff3
documentgetelementbyidbl2styledisplaynone3
documentgetelementbyidsw3stylebackgroundffffff3
px3
minpturbo3
minpwpb3
minpssd3
nbspnbspnbsp3
ssl3
minpcpulimit3
minpemail3
ccua3
nvalidatetimer3
dns3
hdd3
infua3
documentgetelementbyidbl3styledisplaynone3
documentgetelementbyidsw1stylebackgroundffffff3
-3
x3
ltdua3
maxpad3
documentgetelementbyidbl1styledisplaynone3
minpdisk3
minpiis3
393
limextdone3
403
innerxm3
block3
nquotaold3
ndefperiod3
documentgetelementbyidlmst4styledisplay3
documentgetelementbyidlmst4xstyledisplay3
413
423
nquotadb1old3
ndefwpb3
descdivold3
433
sliderncpuslidervalue3
ru3
documentgetelementbyidllegal2styledisplay3
documentgetelementbyidimdetchecked3
ntold3
nqdescold3
donevdson3
443
453
minphvip3
minphvssd3
tar3
buylink3
minphvmem3
minphvcnt3
minphvcpu3
minphvdsk3
463
ncdn3
473
483
493
slidernperiodslidervalue3
slidernturbodescinnerhtml3
503
513
windowslinux3

What are the nameservers for 1gb.ua?

1gb.ua Domain Nameserver Information

HostIP AddressCountry
ns1.1gb.com.ua 195.234.4.10Ukraine Ukraine
uns2.1gb.ru 195.234.5.20Ukraine Ukraine

1gb.ua DNS Record Analysis DNS Lookup

HostTypeTTLExtra
1gb.uaA3588IP: 195.234.4.13
1gb.uaNS3600Target: ns1.1gb.com.ua
1gb.uaNS3600Target: uns2.1gb.ru
1gb.uaSOA3600MNAME: ns1.1gb.com.ua
RNAME: support.1gb.com.ua
Serial: 2917318
Refresh: 900
Retry: 600
Expire: 86400
1gb.uaMX3600Priority: 10
Target: mx1.1gb.com.ua
1gb.uaTXT3600TXT: v=spf1 +a:mx1.1gb.com.ua
+a:u1.1gb.com.ua +a:robots.1gb.ua
+a:u5-xda.1gb.ua +a:uh11.1gb.ua ~all

Alexa Traffic Rank for 1gb.ua


Alexa Search Engine Traffic for 1gb.ua









{**}