Jonas Wagner - 29a.ch

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: 122,361
Estimated Worth: $97,200

29a.ch is the personal website of Jonas Wagner.



Domain summary

Last updated
2021-03-30
Domain label
29a
Domain extension
ch
Global Traffic Rank
122,361
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$97,200
Estimated daily income
$162
Estimated monthly income
$4,928

Frequently Asked Questions (FAQ)

Q: When was 29a.ch registered?
A: 29a.ch was registered 5 months, 3 weeks, 2 days, 15 hours, 3 minutes, 57 seconds ago on Tuesday, March 30, 2021.
Q: When was the WHOIS for 29a.ch last updated?
A: The WHOIS entry was last updated 5 months, 3 weeks, 2 days, 15 hours, 3 minutes, 57 seconds ago on Tuesday, March 30, 2021.
Q: What are 29a.ch's nameservers?
A: DNS for 29a.ch is provided by the following nameservers:
  • kate.ns.cloudflare.com
  • bayan.ns.cloudflare.com
Q: Who is the registrar for the 29a.ch domain?
A: The domain has been registered at SWITCH Domain Name Registration.
Q: What is the traffic rank for 29a.ch?
A: 29a.ch ranks 122,361 globally on Alexa. 29a.ch has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit 29a.ch each day?
A: 29a.ch receives approximately 12,988 visitors and 64,940 page impressions per day.
Q: What IP address does 29a.ch resolve to?
A: 29a.ch resolves to the IPv4 address 172.67.152.180.
Q: In what country are 29a.ch servers located in?
A: 29a.ch has servers located in the United States.
Q: What webserver software does 29a.ch use?
A: 29a.ch is powered by CloudFlare webserver.
Q: Who hosts 29a.ch?
A: 29a.ch is hosted by T-Mobile USA, Inc. in United States.
Q: How much is 29a.ch worth?
A: 29a.ch has an estimated worth of $97,200. An average daily income of approximately $162, which is roughly $4,928 per month.

29a.ch Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

29a.ch Free SEO Report

Website Related Search Terms

Website Inpage Analysis for 29a.ch

H1 Headings

9 :
  1. 29a.ch by Jonas Wagner
  2. I made myself a guitar tuner
  3. Lap Timer and Analyser for GoPro Videos
  4. I made myself a noise generator
  5. Urban Astrophotography
  6. JPEG Forensics in Forensically
  7. Principal Component Analysis for Photo Forensics
  8. Ditherlicious - 1 Bit Image Dithering
  9. Black and White Conversion using PCA

H2 Headings

35 :
  1.  Experiments
  2. TimeStretch Player
  3. Analog Film Emulator
  4. Forensically
  5. Neonflames
  6. Recent Articles
  7. So what’s in it?
  8. Disclaimer
  9. Going beyond the fourier transform
  10. Auto correlation
  11. Picking a peak
  12. Improving accuracy
  13. Improving reliability
  14. Making it fast
  15. What is left to do
  16. Further reading
  17. Data Extraction and Filtering
  18. Lap Map
  19. G-Map
  20. Future Plans
  21. Disclaimer
  22. Step by Step
  23. Why this is possible
  24. Settings & Equipment
  25. Conclusions
  26. Further Reading
  27. JPEG Comments
  28. Quantization Tables
  29. Structural Analysis
  30. String Extraction
  31. Example
  32. First Principal Component
  33. Second Principal Component
  34. Resistance to Compression
  35. Further Reading

H3 Headings

0 :

H4 Headings

7 :
  1. JPEG Patterns
  2. Example quantization table for quality 95
  3. Identifying manipulated images using JPEG quantization tables
  4. Automatic identification of quantization tables
  5. Summary
  6. Additional Resources
  7. Facebook Meta Data

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

30 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

50:

Links - Internal (nofollow)

0:

Links - Outbound

54:

Links - Outbound (nofollow)

0:

Keyword Cloud for 29a.ch

reallyjustinitialastrophotographyarticlespcathenrecentotherpatterns jpeglinebecausearticlefacebookcourseinterestinganotherfirst significantversionforcesmaybeskyplayerfurther readingdenominatorforensicsstartcfar awayfoundanalysisaftermaprecordingourhavepleaseunderstandingmore lightstringrevealgalaxywellallowsespeciallyprojectstandardthan0toolsguesscorrelationpracticedoes notcolorsadditionusebasicthese patternsyouclosewouldyieldhas beenalreadyway to findvaluessomemuchsamplesmeta dataphoto forensicsrightversionsevencamera1principal componenthave beeneasilyyou wantreturnmorelearnstepreadingbeingextractiondoespollutionfilterworkscomponentswagnernbsplotbetterdetailconversionsnpatternscouldlookoriginalphoto forensics toolexampleonealsoplayingif youniceriderlight pollutionrather thanluminosityblack and whiteusingwhite conversionsenoughfilecommentsvariousidtechniquemaketweetshare on facebookphotoquiteleastlapgaugewhite conversion usingmadefindwaythingsampsample ratedidjpeg imageprincipalifresultusing jpegbasedfuturesignificantimagesperfectoffnewcompressionimproveitscausedgeneralquantization tablesfurtherownplaybeencomponentmainyourgetmanyeachsimplehassonoisespeedjonasmcleod philipforensicallydefinitelywindowperiodfartelljpegaroundfiltersbit morealso havewhilefocushzditherliciousmicrophonepeopletermsphilipcompressedforensics toolsignalfrontcaselibrarysettingsoutputmcleodfairlytheyinformationcontainupconversion using pcadohighestvaluedoingusnotmeanscomparedguitarfouriertablewe canlightsif you wantsampleideaaccuracyneeddonemycuriousridingtheiridentifysamealldifferentusedthesefewalwayslittletracknightadditionalverygopromentionedlighttoolimpitchphotosunderstandcreatedratefrequencytherethatsusing pcaanyawayaddqualitynoteblackwhite conversionquantizationsoftwaregoodwantaboveaudiorecommendwantedclearovervehicleinstanceexperimentsphotographswebseestraightyou canstarslikeoftenautocorrelationsavedconversion usingstillshowstwonowdontkalmanjpeg quantizationusing jpeg quantizationtakeits notimagelimitmetabuttrysecondtweetsharesetmyselfwhiteconversionjpeg quantization tablesalgorithmshouldgoingendwhichpossiblephotoshopbuildautowedataletscanfourier transformditheringresolutionbitsomethingtimeheremostbackworkrathercitygive youauto correlationquickgivejobprincipal componentspeakmeaccuratefirstjonas wagnernbsptransformtableslaghelpresultslookinggoutfastformatintotuner

Longtail Keyword Density for 29a.ch

KeywordsOccurences
tweetshare on facebook8
if you want7
black and white5
way to find3
photo forensics tool3
using jpeg quantization3
jpeg quantization tables3
white conversion using3
conversion using pca3
quantization tables16
if you13
we can12
fourier transform10
jonas wagnernbsp8
you want8
you can6
have been6
principal component5
light pollution5
photo forensics5
auto correlation4
jpeg quantization4
jpeg image4
meta data4
principal components3
white conversion3
conversion using3
using jpeg3
patterns jpeg3
using pca3
these patterns3
give you3
more light3
forensics tool3
does not3
far away3
further reading3
also have3
its not3
mcleod philip3
bit more3
sample rate3
first significant3
has been3
rather than3
white conversions3
you38
can32
image31
jpeg26
we25
using25
more23
have22
my22
tables21
if21
bit20
also20
quantization19
not18
its17
but17
data17
so16
some15
light15
one14
find14
images14
like13
still12
signal12
facebook12
tuner12
used12
way12
tool12
first12
comments11
now11
transform11
these11
good10
been10
which10
want10
photo10
there10
fourier10
all10
up9
lot9
me9
camera9
even9
just9
our9
jonas9
noise9
use9
do9
time8
analysis8
much8
look8
does8
while8
software8
different8
above8
get8
wagnernbsp8
web8
tweetshare8
principal8
well8
than8
example8
photoshop8
quite8
pca8
should7
see7
something7
hz7
straight7
gopro7
dont7
forensics7
conversion7
fast7
quality7
results7
amp7
same7
into7
has7
stars7
far6
little6
result6
simple6
interesting6
being6
lets6
im6
version6
very6
resolution6
looking6
would6
standard6
new6
forensically6
play6
learn6
tools6
algorithm6
they6
over6
white6
try6
rather6
black6
already6
peak6
05
take5
another5
really5
work5
filter5
component5
after5
created5
values5
limit5
guitar5
riding5
possible5
need5
map5
sample5
then5
information5
most5
add5
table5
because5
their5
compression5
patterns5
pitch5
pollution5
better5
reading5
contain5
note4
filters4
original4
nice4
give4
works4
right4
photographs4
own4
definitely4
step4
sky4
conversions4
lap4
line4
meta4
other4
speed4
audio4
shows4
rider4
city4
accuracy4
could4
lag4
auto4
microphone4
found4
out4
compressed4
doing4
least4
people4
14
things4
mcleod4
autocorrelation4
philip4
correlation4
articles4
detail4
frequency4
end4
us4
accurate4
two4
initial4
back4
track4
case4
reveal4
course4
basic4
perfect3
dithering3
saved3
often3
each3
versions3
always3
yield3
here3
ditherlicious3
allows3
help3
job3
colors3
instance3
components3
settings3
second3
clear3
technique3
general3
astrophotography3
string3
few3
means3
playing3
night3
lights3
identify3
file3
vehicle3
thats3
close3
rate3
recommend3
mentioned3
going3
significant3
did3
terms3
window3
please3
samples3
practice3
improve3
compared3
fairly3
period3
output3
understand3
understanding3
tell3
made3
experiments3
player3
set3
photos3
your3
recent3
myself3
focus3
idea3
build3
done3
front3
project3
make3
article3
return3
off3
gauge3
around3
any3
further3
away3
recording3
format3
curious3
many3
additional3
extraction3
library3
addition3
g3
forces3
especially3
quick3
maybe3
future3
start3
denominator3
based3
enough3
highest3
value3
easily3
c3
wanted3
id3
various3
main3
guess3
caused3
kalman3
n3
galaxy3
luminosity3

Who hosts 29a.ch?

29a.ch Hosting Provider Information

Hosted IP Address:172.67.152.180
Hosted Hostname:172.67.152.180
Service Provider:T-Mobile USA, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "T-Mobile USA, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
T-Mobile USA, Inc.
1.4318%

HTTP Header Analysis for 29a.ch

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 30 Mar 2021 04:22:53 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 16317
Connection: keep-alive
Last-Modified: Sun, 14 Mar 2021 14:39:56 GMT
Vary: Accept-Encoding
ETag: "604e203c-3fbd"
Content-Encoding: gzip
Cache-Control: max-age=0, s-maxage=720, no-transform, public, must-revalidate
Strict-Transport-Security: max-age=63072000; includeSubDomains; preload
X-UA-Compatible: IE=Edge,chrome=1
CF-Cache-Status: DYNAMIC
cf-request-id: 0922f7d548000006b289a3d000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Report-To: {"group":"cf-nel","endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?s=bLT4ZG7xchUMA6A4pBvR32tpbMcNjUcwGSgSrXSpjkfQVnjBIHNLz86gIHpShfAMFuJH0WmWPVF53NwgsL+vHifQiaaIey0="}],"max_age":604800}
NEL: {"max_age":604800,"report_to":"cf-nel"}
Server: cloudflare
CF-RAY: 637e8f354a9206b2-LHR
alt-svc: h3-27=":443"; ma=86400, h3-28=":443"; ma=86400, h3-29=":443"; ma=86400

29a.ch Domain Nameserver Information

HostIP AddressCountry
kate.ns.cloudflare.com 172.64.32.124
bayan.ns.cloudflare.com 172.64.33.72


Need to find out who hosts 29a.ch?


Domain Registration (WhoIs) information for 29a.ch

 Requests of this client are not permitted. Please use https://www.nic.ch/whois/ for queries. 

Websites with Similar Names

29a.app
Lucky Color
29a.ch
Jonas Wagner - 29a.ch
29a.vip
ERROR: The request could not be satisfied
29a1overheadgdc.com
www.a1overheadgdc.com
29a3.com
29a3.com
29a9.com
29A9论坛

Recently Updated Websites

Stratfordiowa.com (3 seconds ago.)Abf-mexico.com (6 seconds ago.)Badrmoney.com (6 seconds ago.)Bwfcc.org (7 seconds ago.)Mboc.com (8 seconds ago.)West-street.org (10 seconds ago.)Remapintl.org (11 seconds ago.)Coreymote.com (11 seconds ago.)Tonysminingcompany.com (11 seconds ago.)Www611188.com (12 seconds ago.)Dateonsocialmedia.com (13 seconds ago.)Warriorsoulcoaching.com (13 seconds ago.)Seekus.org (13 seconds ago.)Nu-viewglass.biz (14 seconds ago.)Dollarrecoveryassociates.org (15 seconds ago.)Gotnunchi.com (16 seconds ago.)Sexcam-camsex.com (18 seconds ago.)Tylerbryanwrites.com (19 seconds ago.)Enlacemercantil.com (19 seconds ago.)Pierdavis.com (19 seconds ago.)Somaliaamerican.org (20 seconds ago.)Originaenergia.com (20 seconds ago.)Universaltowingmirrors.com.au (21 seconds ago.)Jordanshoeshunt.com (22 seconds ago.)Carhiremauritius-mu.com (22 seconds ago.)Playgreenriver.com (23 seconds ago.)Ektab.com (23 seconds ago.)Lacara-b.com (25 seconds ago.)Singaporepropertyconsultants.com (25 seconds ago.)Sniffylabs.com (27 seconds ago.)

Recently Searched Keywords

careconnectivecom (4 seconds ago.)pda pone (7 seconds ago.)august 2, 2019 (8 seconds ago.)british mom147k (10 seconds ago.)problems in society (10 seconds ago.)the trail starts here... (12 seconds ago.)mikanit levhalar (12 seconds ago.)подошвенные бородавки народные средства (13 seconds ago.)logo-wrapheader-top-logo-panelheader-containerdfd-header-buildernotsmall header-builder-wrrapermobile (14 seconds ago.)cngfarming (16 seconds ago.)terra aeolica τηνος τηλεφωνο (18 seconds ago.)грех (21 seconds ago.)jogapodlozka.cz (28 seconds ago.)formularcenter (29 seconds ago.)cs5 від а до я (30 seconds ago.)аэрозоли и кремы для обуви (34 seconds ago.)seat maps (35 seconds ago.)leisure wrexhamactivity pricesnewsnominate (37 seconds ago.)unterkunft suchen (40 seconds ago.)se concentrer sur le référencement naturel sur google (41 seconds ago.)huśtawki ogrodowe (42 seconds ago.)二年级动物大会看图写话 (43 seconds ago.)daihatsu [4084] (46 seconds ago.)menderes apaydinyerel seçimlerin ardindan (47 seconds ago.)starbucks muestra cómo funcionan sus nuevos vasos caros, que no contaminan (48 seconds ago.)support de plaque (52 seconds ago.)willige (54 seconds ago.)francis mallmann argentine chef (54 seconds ago.)f 44 (55 seconds ago.)themoali (55 seconds ago.)