ДвеТочки - доставка товаров ИКЕА в Ижевск

Safety: Low trust score
Year Founded: 2016
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-11-28
Category: This site has not been categorized yet

Мы доставляем любые товары ИКЕА в Ижевск. +7-922-517-03-36, Ижевск, Кирова, 146, ТЦ "МойПорт", 2 этаж, отдел Две Точки. IKEA, ИКЕА, икея, доставка, Ижевск, мебель, Две Точки


Domain summary

Domain label
2tochki
Domain extension
ru
Domain registered:
2016-03-11
Domain updated:
2020-11-28
Domain expires:
2021-03-11
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is 2tochki.ru ranked relative to other sites:

Percentage of visits to 2tochki.ru from a search engine:


Frequently Asked Questions (FAQ)

Q: When was 2tochki.ru registered?
A: 2tochki.ru was registered 4 years, 10 months, 1 week, 1 day, 1 hour, 33 minutes, 13 seconds ago on Friday, March 11, 2016.
Q: When was the WHOIS for 2tochki.ru last updated?
A: The WHOIS entry was last updated 1 month, 3 weeks, 1 hour, 33 minutes, 13 seconds ago on Saturday, November 28, 2020.
Q: What are 2tochki.ru's nameservers?
A: DNS for 2tochki.ru is provided by the following nameservers:
  • ns10.wixdns.net
  • ns11.wixdns.net
Q: Who is the registrar for the 2tochki.ru domain?
A: The domain has been registered at RU-CENTER-REG-RIPN.
Q: What is the traffic rank for 2tochki.ru?
A: 2tochki.ru has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit 2tochki.ru each day?
A: 2tochki.ru receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does 2tochki.ru resolve to?
A: 2tochki.ru resolves to the IPv4 address 23.236.62.147.
Q: In what country are 2tochki.ru servers located in?
A: 2tochki.ru has servers located in the United States.
Q: What webserver software does 2tochki.ru use?
A: 2tochki.ru is powered by Pepyaka/1.19.0 webserver.
Q: Who hosts 2tochki.ru?
A: 2tochki.ru is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is 2tochki.ru worth?
A: 2tochki.ru has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

2tochki.ru Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

2tochki.ru Free SEO Report

Website Inpage Analysis for 2tochki.ru

H1 Headings

1 :
  1. "Две Точки" - доставка товаров ИКЕА в Ижевск  с 2013 года!

H2 Headings

5 :
  1. ПРИВЕТ!
  2. МЫ ДОСТАВЛЯЕМ ТОВАРЫ ИКЕА
  3. В ИЖЕВСК
  4. ПРИЯТНЫХ
  5. ПОКУПОК!

H3 Headings

3 :
  1. 1
  2. 2
  3. 3

H4 Headings

6 :
  1. КАК МЫ РАБОТАЕМ
  2. УСЛУГИ И ЦЕНЫ
  3. НАШИ
  4. КЛИЕНТЫ
  5. КОНТАКТЫ
  6. КАК СДЕЛАТЬ ЗАКАЗ

H5 Headings

7 :
  1. БЫСТРО
  2. НАДЕЖНО
  3. ЛЕГКО
  4. ДОСТАВКА
  5. ПОДЪЁМ НА ЭТАЖ
  6. СБОРКА И УСТАНОВКА
  7. ПРОЕКТИРОВАНИЕ

H6 Headings

20 :
  1. "ДвеТочки" - доставка товаров ИКЕА в Ижевск
  2. Электронная почта:
  3. [email protected]
  4. Телефон:
  5. +7 (3412) 770-336, 
  6. +7-922-517-03-36
  7. Адрес:
  8. ТЦ "МойПорт", 2 этаж
  9. ул. Кирова, 146, г. Ижевск
  10. Viber, WhatsApp
  11. 89225170336 
  12. Социальные сети:
  13. vk.com/2tochki
  14. www.instagram.com/2tochki
  15. РЕЖИМ РАБОТЫ:
  16. Каждый день с 09:00 до 20:00 (в праздничные дни режим работы уточняйте по телефону 770-336)
  17. Если у вас остались вопросы, пожалуйста, заполните форму:
  18. МЕНЮ
  19. КОНТАКТЫ
  20. СОЦСЕТИ

Total IFRAMEs

1 :

Total Images

25 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for 2tochki.ru

1 verticalmenu1menucontainer220 1normal 700 14px14emstyleke5ksly4labelwrapperstyleit8fsc66navcontainerarrow04s ease 0sselectborderwidth2pxbordercolorrgba204 204normalborderwidth3pxverticalmenu1menucontainercenterdirectionborderwidth2px borderstylesolidbordercolorrgba249 249verticalmenu1submenu verticalmenu1item76 1200 220 1255 1borderstylesolidbordercolorrgba31borderstylesolidbordercolorrgba249 249backgroundcolor ffffff14normal normal normal79225170336 146 2980px1backgroundcolorrgba255 255textalignleftstyleit8fsc66navcontainersvgcontainer255 255 1marginleftolborderwidth1pxrgba0 0 0verticalmenu1menucontainerarrowverticalmenu1menucontainerrightdirection79225170336 146700 14px14em249 1backgroundcolorrgba255 255metakeywordsseopagetitleseostyleit8fsc66navcontainerarrowstyleit8fsc66navcontainerrightdirectionselectfocusverticalmenu1submenuimportantleftauto0046472 ikea metakeywordsseopagetitleseoselectdatapreviewfocusikea metakeywordsseopagetitleseo pageuriseoblankhidepagefalsemobilehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpit8drep0bgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorffffffaligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorffffffaligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemk8g9c3d2metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri5040d0c715563aea62489481bf9d4e6b96c18amv2jpgwidth3016height3016altadvancedseodatatagstypemetapropsnamekeywordscontentikeaikea31 styleit8fsc66navcontainerbackgroundcolorrgba255 255 255verticalmenu1submenubefore200 220topautobottom01borderstylesolidbordercolorrgba31metakeywordsseopagetitleseo pageuriseoblankhidepagefalsemobilehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpit8drep0bgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorffffffaligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorffffffaligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemk8g9c3d2metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri5040d0c715563aea62489481bf9d4e6b96c18amv2jpgwidth3016height3016altadvancedseodatatagstypemetapropsnamekeywordscontentikeatxtnew ulbackgroundcolor980px 05strc1inlinecontent04s8nbspmargin0fontnormal normal normal2boxshadownone0249 2491font normal normal1borderstylesolidbordercolorrgba0 200 220styleke5kslxx1textareaselectdatapreviewerror verticalmenu1menucontainerarrowstyleke5kslxpinputfontnormal normal 700color1f304cnbsp nbspverticalmenu1itempointereventsnoneverticalmenu1menucontainerleftdirectionoldirrtlultxtnew oldisplaynoneborderstylesolidbordercolorrgba249 249 249font712textaligncenter79225170336146 2marginleft calc100 980px5borderstylesolidbordercolorrgba2491backgroundcolorrgba255 255 255positionfixed importantleftautopageuriseoblankhidepagefalsemobilehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpit8drep0bgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorffffffaligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorffffffaligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemk8g9c3d2metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri5040d0c715563aea62489481bf9d4e6b96c18amv2jpgwidth3016height3016altadvancedseodatatagstypemetapropsnamekeywordscontentikeaeaseselectdatapreviewerror styleit8fsc66navcontainerarrowimportantzindex501005s ease0 048 762 ikeadinnextw01lightdinnextw02lightdinnextw10lightsansseriftxtnewmargin0lineheightnormalletterspacingnormal txtnewmetakeywordsseopagetitleseo pageuriseoblankhidepagefalsemobilehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpit8drep0bgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorffffffaligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorffffffaligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemk8g9c3d2metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri5040d0c715563aea62489481bf9d4e6b96c18amv2jpgwidth3016height3016altadvancedseodatatagstypemetapropsnamekeywordscontentikea 146146 2 ikea255 1 styleit8fsc66navcontainerborderleft0borderwidth3px backgroundcolorrgba255color00c8dcstyleit8fsc66navcontainerarrow styleit8fsc66navcontainersvgcontainerstyleke5ksly4linknormal normal 14px14em700 16px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserif05s15displaywebkitboxdisplaywebkitflexdisplayflexwebkitboxorientverticalwebkitboxdirectionnormalwebkitflexdirectioncolumnflexdirectioncolumn255 25516px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserifverticalmenu1menucontainerarrow05borderwidth1px backgroundcolorrgba255 255255 255 1borderstylesolidbordercolorrgba31styleit8el9hgbgikea metakeywordsseopagetitleseostyleit8fsc66navcontainerleftdirectionultxtnewvarbackgroundcolorrgba255ul255 1 verticalmenu1menucontainerverticalmenu1menucontainerarrowverticalmenu1menucontainercenterdirection4verticalmenu1menucontainersvgcontainer16margin0lineheightnormalletterspacingnormalverticalmenu1menucontainerarrow verticalmenu1menucontainersvgcontainernbsp nbsp nbspol ul16px14embackgroundcolorrgba255 255verticalmenu1menucontainerrightdirection14px14emnormal 14px14emverticalmenu1menucontainercolor ffffffboxsizingborderboxbordertop4pxselectdatapreviewhovercalc100rgba0 01borderstylesolidbordercolorrgba31 481borderstylesolidbordercolorrgba31 48 76borderwidth2pxbordercolorrgba204 204 204ease 0snbspnbsppositionabsolutetop0right0bottom0left0700 14px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserifcolor48 76 1borderradius0700 16px14em05s ease 0sborderwidth2px borderstylesolidbordercolorrgba249styleit8fsc66repeaterbuttonlabelverticalmenu1menucontainerarrowverticalmenu1menucontainerleftdirection14px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserif0pxverticalmenu1labelborderwidth2pxbordercolorrgba204styleit8fsc66navcontainerrightdirectioniffont normal130sborderright0lb1itemscontainernormal 700 16px14emrgba0importantleftauto importantzindex506204 204styleit8fsc66navcontainersoliddinnextw01lightdinnextw02lightdinnextw10lightsansserif color00c8dcborderwidth2px04s easefontnormal11normal normalstrc1dataresponsive255 255 1borderstylesolidbordercolorrgba0important255 1borderstylesolidbordercolorrgba09styleke5ksly4labeltransformcalc100 980pxselecthoverboxsizingborderboxbordertop4px solidselectdataerrortruepositionfixed importantleftauto importantzindex50fontnormal normalstyleit8fsc66navcontainerarrowstyleit8fsc66navcontainercenterdirection1borderstylesolidbordercolorrgba0 200pageuriseoblankhidepagefalsemobilehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpit8drep0bgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorffffffaligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorffffffaligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitemk8g9c3d2metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri5040d0c715563aea62489481bf9d4e6b96c18amv2jpgwidth3016height3016altadvancedseodatatagstypemetapropsnamekeywordscontentikea 146borderwidth1px backgroundcolorrgba2551backgroundcolorrgba255styleit8fsc66navcontainercenterdirectionnormal 700ffffff255 11borderstylesolidbordercolorrgba0selectdatapreviewerrormarginleft calc1001pxcalc100 980px 05normal 14px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserifb0b0b0249 249 1backgroundcolorrgba255255 1borderstylesolidbordercolorrgba31 48borderwidth3px backgroundcolorrgba255 255positionfixed249 1backgroundcolorrgba255255 1borderstylesolidbordercolorrgba0 200contentstyleit8fsc66navcontainerarrowstyleit8fsc66navcontainerleftdirection

Longtail Keyword Density for 2tochki.ru

KeywordsOccurences
calc100 980px 0588
margin-left calc100 980px88
background-colorrgba255 255 25515
normal normal normal11
font normal normal11
255 255 19
border-stylesolidborder-colorrgba249 249 2499
249 249 1background-colorrgba2558
249 1background-colorrgba255 2558
1background-colorrgba255 255 2558
200 220 18
border-width2px border-stylesolidborder-colorrgba249 2498
04s ease 0s7
normal normal 14px14em7
255 1border-stylesolidborder-colorrgba0 2006
255 255 1border-stylesolidborder-colorrgba06
border-width3px background-colorrgba255 2556
1border-stylesolidborder-colorrgba0 200 2206
fontnormal normal normal6
normal 14px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif6
fontnormal normal 7006
146 2 ikea5
7-922-517-03-36 146 25
48 76 15
1border-stylesolidborder-colorrgba31 48 764
255 1border-stylesolidborder-colorrgba31 484
255 255 1border-stylesolidborder-colorrgba314
normal 700 16px14em4
border-width1px background-colorrgba255 2554
700 16px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif4
rgba0 0 04
255 1 verticalmenu1menucontainer4
border-width2pxborder-colorrgba204 204 2044
255 1 style-it8fsc66navcontainer4
05s ease 0s3
700 14px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif3
normal 700 14px14em3
nbsp nbsp nbsp3
positionfixed importantleftauto importantz-index503
2 ikea metakeywordsseopagetitleseo3
ikea metakeywordsseopagetitleseo pageuriseoblankhidepagefalsemobilehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpit8drep0bgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorffffffaligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorffffffaligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-k8g9c3d2metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri5040d0c715563aea62489481bf9d4e6b96c18amv2jpgwidth3016height3016altadvancedseodatatagstypemetapropsnamekeywordscontentikea3
metakeywordsseopagetitleseo pageuriseoblankhidepagefalsemobilehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpit8drep0bgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorffffffaligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorffffffaligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-k8g9c3d2metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri5040d0c715563aea62489481bf9d4e6b96c18amv2jpgwidth3016height3016altadvancedseodatatagstypemetapropsnamekeywordscontentikea 1463
980px 0588
margin-left calc10088
calc100 980px88
255 25529
normal normal28
background-colorrgba255 25515
0 012
200 22012
fontnormal normal12
font normal11
ease 0s10
48 7610
border-stylesolidborder-colorrgba249 2499
255 19
nbsp nbsp9
14px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif9
249 2499
04s ease8
1background-colorrgba255 2558
249 1background-colorrgba2558
220 18
border-width2px border-stylesolidborder-colorrgba2498
204 2047
normal 14px14em7
margin0line-heightnormalletter-spacingnormal txtnew7
normal 7007
1border-stylesolidborder-colorrgba0 2006
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif color00c8dc6
border-width3px background-colorrgba2556
255 1border-stylesolidborder-colorrgba06
146 25
2 ikea5
76 15
7-922-517-03-36 1465
16px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif5
1 verticalmenu1menucontainer5
1 style-it8fsc66navcontainer5
255 1border-stylesolidborder-colorrgba314
border-width1px background-colorrgba2554
1border-stylesolidborder-colorrgba31 484
border-width2pxborder-colorrgba204 2044
700 16px14em4
rgba0 04
color ffffff4
background-color ffffff4
txtnew ul4
metakeywordsseopagetitleseo pageuriseoblankhidepagefalsemobilehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpit8drep0bgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorffffffaligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorffffffaligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-k8g9c3d2metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri5040d0c715563aea62489481bf9d4e6b96c18amv2jpgwidth3016height3016altadvancedseodatatagstypemetapropsnamekeywordscontentikea3
ikea metakeywordsseopagetitleseo3
positionfixed importantleftauto3
importantleftauto importantz-index503
ultxtnew ol3
ol ul3
05s ease3
box-sizingborder-boxborder-top4px solid3
700 14px14em3
style-it8fsc66navcontainerarrow style-it8fsc66navcontainersvgcontainer3
selectdata-previewerror style-it8fsc66navcontainerarrow3
verticalmenu1submenu verticalmenu1item3
verticalmenu1menucontainerarrow verticalmenu1menucontainersvgcontainer3
selectdata-previewerror verticalmenu1menucontainerarrow3
pageuriseoblankhidepagefalsemobilehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpit8drep0bgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorffffffaligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorffffffaligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-k8g9c3d2metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri5040d0c715563aea62489481bf9d4e6b96c18amv2jpgwidth3016height3016altadvancedseodatatagstypemetapropsnamekeywordscontentikea 1463
calc10088
margin-left88
980px88
0588
058
normal52
color37
background-color37
132
230
nbsp27
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif22
txtnew18
318
416
background-colorrgba25515
verticalmenu1menucontainer15
positionabsolutetop0right0bottom0left013
513
style-it8fsc66navcontainer13
fontnormal12
612
verticalmenu1menucontainerarrow11
ul11
style-it8fsc66navcontainerarrow11
ease11
font11
711
important10
verticalmenu1submenu10
0s10
810
14px14em10
910
1010
border-stylesolidborder-colorrgba2499
style-ke5kslxpinput8
border-width2px8
0px8
04s8
1background-colorrgba2558
ffffff8
var7
verticalmenu1item7
margin0line-heightnormalletter-spacingnormal7
ol7
border-width3px7
7-922-517-03-367
ikea7
117
style-it8fsc66navcontainerarrowstyle-it8fsc66navcontainerright-direction6
selectdata-previewerror6
selectdata-errortrue6
verticalmenu1menucontainerarrowverticalmenu1menucontainerright-direction6
style-it8fsc66navcontainerarrowstyle-it8fsc66navcontainercenter-direction6
verticalmenu1menucontainerarrowverticalmenu1menucontainerleft-direction6
selectfocus6
verticalmenu1menucontainerarrowverticalmenu1menucontainercenter-direction6
1border-stylesolidborder-colorrgba06
style-ke5kslxx1textarea6
selectdata-previewfocus6
selecthover6
selectdata-previewhover6
color00c8dc6
solid6
rgba06
16px14em6
style-it8fsc66navcontainerarrowstyle-it8fsc66navcontainerleft-direction6
displaynone5
content5
if5
ultxtnew5
transform4
color1f304c4
text-alignleft4
style-ke5ksly4labelwrapper4
1px4
text-aligncenter4
style-ke5ksly4link4
style-ke5ksly4label4
124
verticalmenu1label4
0046474
select4
134
border-width2pxborder-colorrgba2044
border-radius04
style-it8fsc66repeaterbuttonlabel4
border-width1px4
lb1itemscontainer4
b0b0b04
1border-stylesolidborder-colorrgba314
nbspnbsp3
metakeywordsseopagetitleseo3
importantz-index503
143
153
importantleftauto3
positionfixed3
topautobottom03
163
verticalmenu1menucontainercenter-direction3
05s3
pointer-eventsnone3
style-it8fsc66navcontainerleft-direction3
style-it8fsc66navcontainersvgcontainer3
border-right03
style-it8fsc66navcontainerright-direction3
border-left03
style-it8fsc66navcontainercenter-direction3
display-webkit-boxdisplay-webkit-flexdisplayflex-webkit-box-orientvertical-webkit-box-directionnormal-webkit-flex-directioncolumnflex-directioncolumn3
margin03
box-sizingborder-boxborder-top4px3
style-it8el9hgbg3
strc1data-responsive3
verticalmenu1submenubefore3
strc1inlinecontent3
verticalmenu1menucontainersvgcontainer3
verticalmenu1menucontainerleft-direction3
oldirrtl3
verticalmenu1menucontainerright-direction3
box-shadownone3
pageuriseoblankhidepagefalsemobilehidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpit8drep0bgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorffffffaligntypecenterfittingtypefillscrolltypefixedcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg24tametadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsecolorffffffaligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimageogimagereftypeimageiddataitem-k8g9c3d2metadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsetitleuri5040d0c715563aea62489481bf9d4e6b96c18amv2jpgwidth3016height3016altadvancedseodatatagstypemetapropsnamekeywordscontentikea3

Who hosts 2tochki.ru?

2tochki.ru Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Pepyaka/1.19.0

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%

HTTP Header Analysis for 2tochki.ru

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 28 Nov 2020 14:05:28 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
x-wix-request-id: 1606572328.65876738266715316
link:; rel=preconnect; crossorigin,; rel=preconnect; crossorigin,; rel=preconnect;,; rel=preload; as=script;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preconnect; crossorigin;,; rel=preload; as=script ; crossorigin=anonymous
content-language: en
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=euw2
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Vary: Accept-Encoding
X-Seen-By: sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVhQj1BaGUHEZdeNXf9X2Qzk,2d58ifebGbosy5xc FRaloPX4ngKfQM8fEHbwELHijkqxMZvnmmqAYXvv1RUDwiJWIHlCalF7YnfvOr2cMPpyw==,Nlv1KFVtIvAfa3AK9dRsI7BVC93YiKOuCeaM0z/uEIUfbJaKSXYQ/lskq2jK6SGP,2UNV7KOq4oGjA5 PKsX47Hq5 b0VQ/rWZOC7aIKn1HQ=,qquldgcFrj2n046g4RNSVLBEueY9AnibOH2EZLjRrdE=,LXlT8qjS5x6WBejJA3 gBTvExe0rD614gCaQEafP0hV9pAiCxHhredE3m8SaSeMp,kO0u 7q TL0DeeE//9W7MD/KSVSGvx0MdPkgC86GTXyQDMZvvzCFhvHyDqV93OR0,LXlT8qjS5x6WBejJA3 gBTvExe0rD614gCaQEafP0hV9pAiCxHhredE3m8SaSeMp,Tw2AanFDQ Wwo8Xxk6ZL7vOBx hvh2Cbd7MMNUXzbHF0nIyI83OE/m6it5hjj e5YuVlB3Hm0Fzu/K0bd8jHCGWOZMAUB91B2FPLwJnMGio=,l7Ey5khejq81S7sxGe5Nky0R/FBrIpH4k5wlWh0nfVKTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,l7Ey5khejq81S7sxGe5NkzliAE89IHJFmMwtqusSsEuTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,LlHHrtdZwfqSTe7u8ayFI0G3ybJlEMQoDW11NrJgY4TpRXFIeLVdvoOG0jKAykTj2OjVvfCIDFAZ3fIjA1u7HA==,l7Ey5khejq81S7sxGe5Nky0R/FBrIpH4k5wlWh0nfVKTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,Ts 7R/4FijtA6c9psi3FQF21bUhqbCTLiVLoXVNAwQaTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,CU5GbgCT5nWPaA3tUS4mLGIKXacaXu6vTDycYV TU elLW25RGm5GO4bR/RDvCbWXs091Ywmo28pWnQtfjNW3g==
cache-control: private,max-age=0,must-revalidate
Server: Pepyaka/1.19.0
Content-Encoding: gzip

2tochki.ru Domain Nameserver Information

HostIP AddressCountry
ns10.wixdns.net 216.239.36.100
ns11.wixdns.net 216.239.38.100


Need to find out who hosts 2tochki.ru?


Domain Registration (WhoIs) information for 2tochki.ru

 % By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: 2TOCHKI.RU
nserver: ns10.wixdns.net.
nserver: ns11.wixdns.net.
state: REGISTERED, DELEGATED, VERIFIED
person: Private Person
registrar: R01-RU
admin-contact: https://partner.r01.ru/contact_admin.khtml
created: 2016-03-11T20:01:58Z
paid-till: 2021-03-11T20:01:58Z
free-date: 2021-04-11
source: TCI

Last updated on 2020-11-28T14:01:32Z

Websites with Similar Names

2tochki.com
2tochki.com
2tochki.ru
ДвеТочки - доставка товаров ИКЕА в Ижевск

Recently Updated Websites

Capitalpropertyshop.com (2 minutes 55 seconds ago.)Hkjysks.com (2 minutes 56 seconds ago.)Guifiepragre.tk (3 minutes ago.)Gartencenter-lueske.de (3 minutes 6 seconds ago.)Poots.net (3 minutes 7 seconds ago.)Now.tm (3 minutes 7 seconds ago.)Painteroffun.com (3 minutes 7 seconds ago.)Bossest.com (3 minutes 7 seconds ago.)Haughty.org (3 minutes 7 seconds ago.)Winnerve.com (3 minutes 7 seconds ago.)Venus-diving.com (3 minutes 7 seconds ago.)Otv.info (3 minutes 7 seconds ago.)Real3dmodel.com (3 minutes 7 seconds ago.)Halotan.net (3 minutes 7 seconds ago.)Sistersoftheborderlands.com (3 minutes 8 seconds ago.)Lymfom.com (3 minutes 8 seconds ago.)Chukyso.org (3 minutes 8 seconds ago.)Bankcfl.com (3 minutes 8 seconds ago.)Bvrecs.co.za (3 minutes 8 seconds ago.)Tritondata.com (3 minutes 8 seconds ago.)Analyticsofserp.com (3 minutes 8 seconds ago.)Daboodle.biz (3 minutes 8 seconds ago.)Artery-for-crafters.com (3 minutes 8 seconds ago.)Gifts.show (3 minutes 8 seconds ago.)Devilshandjobs.com (3 minutes 8 seconds ago.)Avw.it (3 minutes 8 seconds ago.)Gangesp.com (3 minutes 8 seconds ago.)Rawhoney.co.uk (3 minutes 8 seconds ago.)Ubc-university.services (3 minutes 8 seconds ago.)Theemerald.org (3 minutes 8 seconds ago.)

Recently Searched Keywords

  practice series (1 second ago.)recambios thetford porta potti (2 seconds ago.)cycling socks (3 seconds ago.)savings (3 seconds ago.)����ս������ij�����ϴ��̽��ҽ�Ʒ�������ģʽ (5 seconds ago.)infrastructure projects (7 seconds ago.)order (10 seconds ago.)more info gt (15 seconds ago.)ֱ������չ�����ľ����ٳ��� (16 seconds ago.)most (16 seconds ago.)клей lab arte bond pu 3014 stp однокомпонентный модифицированный (17 seconds ago.)super8 (17 seconds ago.)padding 0 -moz-border-radius (18 seconds ago.)nhà đầu tư lo gì trước bầu cử mỹ (19 seconds ago.)1 win (20 seconds ago.)products (22 seconds ago.)long styles (24 seconds ago.)bí quyết làm giò chả ước lễ đúng công thức, chuẩn hương vị (24 seconds ago.)just a transaction (25 seconds ago.)trusted-tablets (26 seconds ago.)way (26 seconds ago.)sqs-slide-layer-contentsqs-slide-wrapperdata-slide-typecover-page (27 seconds ago.)bent u (33 seconds ago.)we (39 seconds ago.)into (44 seconds ago.)波兰剧 (47 seconds ago.)glossygurlzz (49 seconds ago.)deutsche industrie und handelskammertag dihk (49 seconds ago.)trusted (49 seconds ago.)ðŸð°ñ‚ñ‚ð°ð¹ñ (50 seconds ago.)