5ème Saison parce que 4 c'est trop peu !

Safety: Low trust score
Year Founded: 2019
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Blog d'informations, découvertes, aventures... quel que soit le temps et la saison !



Domain summary

Last updated
2020-11-03
Domain label
5emesaison
Domain extension
fr
Domain registered:
2019-02-14
Domain updated:
2020-01-21
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was 5emesaison.fr registered?
A: 5emesaison.fr was registered 2 years, 11 months, 1 week, 3 days, 13 hours, 56 minutes, 16 seconds ago on Thursday, February 14, 2019.
Q: When was the WHOIS for 5emesaison.fr last updated?
A: The WHOIS entry was last updated 2 years, 3 days, 13 hours, 56 minutes, 16 seconds ago on Tuesday, January 21, 2020.
Q: What are 5emesaison.fr's nameservers?
A: DNS for 5emesaison.fr is provided by the following nameservers:
  • ns-canada.topdns.com
  • ns-uk.topdns.com
  • ns-usa.topdns.com
Q: Who is the registrar for the 5emesaison.fr domain?
A: The domain has been registered at AFNIC.
Q: What is the traffic rank for 5emesaison.fr?
A: 5emesaison.fr has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit 5emesaison.fr each day?
A: 5emesaison.fr receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does 5emesaison.fr resolve to?
A: 5emesaison.fr resolves to the IPv4 address 109.234.165.81.
Q: In what country are 5emesaison.fr servers located in?
A: 5emesaison.fr has servers located in the France.
Q: What webserver software does 5emesaison.fr use?
A: 5emesaison.fr is powered by O2switch-PowerBoost-v3 webserver.
Q: Who hosts 5emesaison.fr?
A: 5emesaison.fr is hosted by o2switch SARL in France.
Q: How much is 5emesaison.fr worth?
A: 5emesaison.fr has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

5emesaison.fr Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

5emesaison.fr Free SEO Report

Website Inpage Analysis for 5emesaison.fr

H1 Headings

0 :

H2 Headings

1 :
  1. 5ème Saison

H3 Headings

5 :
  1. Comment se reconvertir en diagnostiqueur immobilier ?
  2. Focus sur le métier de diagnostiqueur immobilier
  3. Se libérer du temps, de l’énergie et des risques en louant un monte meuble à Paris
  4. Et si ma petite entreprise faisait appel à une agence de communication ?
  5. Pourquoi personnaliser des vêtements de travail pour son entreprise ?

H4 Headings

2 :
  1. 4 saisons, c’est trop peu :
  2. Articles Récents

H5 Headings

2 :
  1. Le 12 et 13 septembre, le salon « Passionnément Jardin » à Honfleur a attiré de nombreux curieux
  2. Culture biologique de la tomate : Ce qu’il faut d’abord savoir

H6 Headings

13 :
  1. Trouver l’électricien qu’il vous faut à Rennes
  2. Les raisons pour changer vos fenêtres
  3. Le 12 et 13 septembre, le salon « Passionnément Jardin » à Honfleur a attiré de nombreux curieux
  4. Comment se reconvertir en diagnostiqueur immobilier ?
  5. Focus sur le métier de diagnostiqueur immobilier
  6. Trouver l’électricien qu’il vous faut à Rennes
  7. Se libérer du temps, de l’énergie et des risques en louant un monte meuble à Paris
  8. 5 étapes pour restaurer une 2CV
  9. Les raisons pour changer vos fenêtres
  10. Et si ma petite entreprise faisait appel à une agence de communication ?
  11. Support moto Quad Lock : l’astucieuse alternative au GPS
  12. Culture biologique de la tomate : Ce qu’il faut d’abord savoir
  13. Le 12 et 13 septembre, le salon « Passionnément Jardin » à Honfleur a attiré de nombreux curieux

Total IFRAMEs

0 :

Total Images

21 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

33:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for 5emesaison.fr

honfleurjardinqursquoil vous fautet 13 septembrefocus sur lemontelepourfautunfocusvous faut rennestrouver lrsquolectricien0seqursquoilet 13mtier de diagnostiqueurdes risques3septembre 18 202012 etle 12sur le mtierdiagnostiqueur immobiliernombreux curieuxseptembre le salon12 et 13salon passionnment jardinnombreuxnombreux curieux septembrelrsquolectricien qursquoil vousmai 13 2019librerqursquoil vousquilvous fautjardin honfleurduseptembremeuble parisun montedu temps13 2019se librerseptembre lese librer dulouant unlrsquolectricien qursquoillrsquonergie etet des risquesreconvertir en diagnostiqueurlrsquolectriciencommentsmonte meublemtierlrsquonergie et descommentfaut rennesuneentreprisereconvertirlesmonte meuble parisdestemps de lrsquonergiecomment setrouver13 septembre le5immobilierfocus surlibrer du tempsmairisqueslouantcurieux septembresur le13 septembreseptembre 181mai 13salonchangerattir de nombreuxcecurieux septembre 18risques en louantlouant un montecomment se reconvertiret4salon passionnmentle salon passionnmenthonfleur a attirlibrer dule mtierattirpassionnmentbiologiquediagnostiqueurle 12 etpassionnment jardin honfleurtomatetempsparisrennessurcurieux218 2020un monte meublepassionnment jardintrouver lrsquolectricien qursquoille salonet desmeublevousse reconvertir0 commentslrsquonergie

Longtail Keyword Density for 5emesaison.fr

KeywordsOccurences
le salon passionnment7
salon passionnment jardin7
attir de nombreux5
honfleur a attir5
passionnment jardin honfleur5
septembre le salon5
13 septembre le5
et 13 septembre5
12 et 135
le 12 et5
comment se reconvertir4
lrsquolectricien qursquoil vous4
vous faut rennes4
reconvertir en diagnostiqueur4
qursquoil vous faut4
trouver lrsquolectricien qursquoil4
monte meuble paris4
focus sur le4
sur le mtier4
mtier de diagnostiqueur4
se librer du4
librer du temps4
temps de lrsquonergie4
lrsquonergie et des4
et des risques4
risques en louant4
louant un monte4
un monte meuble4
mai 13 20193
nombreux curieux septembre3
curieux septembre 183
septembre 18 20203
diagnostiqueur immobilier8
passionnment jardin7
salon passionnment7
le salon7
nombreux curieux5
jardin honfleur5
septembre le5
13 septembre5
et 135
12 et5
le 125
comment se4
se reconvertir4
13 20194
faut rennes4
vous faut4
qursquoil vous4
lrsquolectricien qursquoil4
trouver lrsquolectricien4
focus sur4
sur le4
le mtier4
se librer4
librer du4
du temps4
lrsquonergie et4
et des4
des risques4
louant un4
un monte4
monte meuble4
meuble paris4
0 comments3
mai 133
curieux septembre3
septembre 183
18 20203
le20
jardin12
et11
09
entreprise9
se8
diagnostiqueur8
immobilier8
septembre8
honfleur7
des7
pour7
17
salon7
passionnment7
vous6
faut6
du5
sur5
attir5
nombreux5
25
curieux5
un5
quil5
qursquoil4
ce4
rennes4
paris4
lrsquolectricien4
trouver4
les4
comment4
reconvertir4
focus4
mtier4
librer4
temps4
lrsquonergie4
risques4
louant4
monte4
meuble4
une4
changer3
comments3
33
mai3
43
53
biologique3
tomate3

Who hosts 5emesaison.fr?

5emesaison.fr Hosting Provider Information

Hosted IP Address:109.234.165.81
Hosted Hostname:109-234-165-81.reverse.odns.fr
Service Provider:o2switch SARL
Hosted Country:FranceFR
Location Latitude:48.8582
Location Longitude:2.3387
Webserver Software:o2switch-PowerBoost-v3

Is "o2switch SARL" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
19.8811%
GOOGLE
13.4918%
AS-26496-GO-DADDY-COM-LLC
3.5494%
NAMECHEAP-NET
3.0231%
AMAZON-AES
2.1497%
GoDaddy.com, LLC
2.0016%
UNIFIEDLAYER-AS-1
1.8740%
Fara Negar Pardaz Khuzestan
1.5314%
CONFLUENCE-NETWORK-INC
1.4027%
1&1 Internet AG
1.2887%
o2switch SARL
0.0301%

HTTP Header Analysis for 5emesaison.fr

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 03 Nov 2020 10:50:14 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Link:; rel="https://api.w.org/"
Server: o2switch-PowerBoost-v3
Content-Encoding: gzip

5emesaison.fr Domain Nameserver Information

HostIP AddressCountry
ns-canada.topdns.com 109.201.142.225
ns-uk.topdns.com 108.61.150.91
ns-usa.topdns.com 46.166.189.99


Need to find out who hosts 5emesaison.fr?


Domain Registration (WhoIs) information for 5emesaison.fr

 %%
%% This is the AFNIC Whois server.
%%
%% complete date format : YYYY-MM-DDThh:mm:ssZ
%% short date format : DD/MM
%% version : FRNIC-2.5
%%
%% Rights restricted by copyright.
%% See https://www.afnic.fr/en/products-and-services/services/whois/whois-special-notice/
%%
%% Use '-h' option to obtain more information about this service.
%%
%% [64.227.39.167 REQUEST] >> 5emesaison.fr
%%
%% RL Net [##########] - RL IP [#########.]
%%

domain: 5emesaison.fr
status: ACTIVE
hold: NO
holder-c: ANO00-FRNIC
admin-c: ANO00-FRNIC
tech-c: DA55158-FRNIC
zone-c: NFC1-FRNIC
nsl-id: NSL30021-FRNIC
registrar: TLD Registrar Solutions Ltd
Expiry Date: 2021-02-14T13:32:22Z
created: 2019-02-14T13:32:22Z
last-update: 2020-01-21T04:32:56Z
source: FRNIC

ns-list: NSL30021-FRNIC
nserver: ns-canada.topdns.com
nserver: ns-uk.topdns.com
nserver: ns-usa.topdns.com
source: FRNIC

registrar: TLD Registrar Solutions Ltd
type: Isp Option 1
address: 35-39 Moorgate
address: Level 1
address: EC2R 6AR LONDON
country: GB
phone: +44 2034357304
e-mail: Login to show email
https://internetbs.net/en/domain-name-registrations/price.html?setCurrency=EUR
anonymous: NO
registered: 2014-11-17T12:00:00Z
source: FRNIC

nic-hdl: ANO00-FRNIC
type: PERSON
contact: Ano Nymous
remarks: -------------- WARNING --------------
remarks: While the registrar knows him/her,
remarks: this person chose to restrict access
remarks: to his/her personal data. So PLEASE,
remarks: don't send emails to Ano Nymous. This
remarks: address is bogus and there is no hope
remarks: of a reply.
remarks: -------------- WARNING --------------
registrar: TLD Registrar Solutions Ltd
changed: 2019-02-14T13:31:04Z [email protected]
anonymous: YES
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: ANO00-FRNIC
type: PERSON
contact: Ano Nymous
remarks: -------------- WARNING --------------
remarks: While the registrar knows him/her,
remarks: this person chose to restrict access
remarks: to his/her personal data. So PLEASE,
remarks: don't send emails to Ano Nymous. This
remarks: address is bogus and there is no hope
remarks: of a reply.
remarks: -------------- WARNING --------------
registrar: TLD Registrar Solutions Ltd
changed: 2019-02-14T13:31:04Z [email protected]
anonymous: YES
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: DA55158-FRNIC
type: PERSON
contact: Domain Admin
address: TLD Registrar Solutions Ltd
address: Lvl 1, 35-39 Moorgate
address: EC2R 6AR London
country: GB
phone: +44.2034357312
fax-no: +44.2033880601
e-mail: Login to show email
TLD Registrar Solutions Ltd
changed: 2019-06-19T16:32:56Z Login to show email
NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

Websites with Similar Names

5emesaison.fr
5ème Saison parce que 4 c'est trop peu !
5emeset-lefilm.com
5eme set, le film

Recently Updated Websites

Foro.elhacker.net (10 minutes 37 seconds ago.)Saffran-sa.com (18 minutes 11 seconds ago.)Shopsevensixteen.com (22 minutes 24 seconds ago.)Itrate.co (23 minutes 58 seconds ago.)Aa88bet.com (27 minutes 39 seconds ago.)Cragro.com (1 hour 2 minutes ago.)Nazarbangla.com (1 hour 5 minutes ago.)Powerfultantrik.com (1 hour 9 minutes ago.)Aakaarbonecare.com (1 hour 10 minutes ago.)Uniquefloorcovering.com.au (1 hour 10 minutes ago.)Stuntparts.com (1 hour 24 minutes ago.)54thstreetgym.com (1 hour 24 minutes ago.)Jinmedental.cn (1 hour 24 minutes ago.)Sinistralva.com (1 hour 24 minutes ago.)Kleinlautblog.com (1 hour 24 minutes ago.)Skatenv.com (1 hour 24 minutes ago.)Elonmusty.com (1 hour 24 minutes ago.)Crystalcolefitness.com (1 hour 24 minutes ago.)Cinemaimax.com (1 hour 24 minutes ago.)Aoa3704.app (1 hour 24 minutes ago.)Huohuvip5319.com (1 hour 24 minutes ago.)Mikequeenexposed.com (1 hour 24 minutes ago.)Columbuschurchvideo.com (1 hour 24 minutes ago.)Escuadrones.es (1 hour 24 minutes ago.)Drugfreefamilies.org (1 hour 24 minutes ago.)Tzabaneh.com (1 hour 24 minutes ago.)Rackhamgardens.com (1 hour 24 minutes ago.)Goodpeoplegreatmovers.com (1 hour 24 minutes ago.)Bft26800.com (1 hour 24 minutes ago.)Propaganda.email (1 hour 24 minutes ago.)

Recently Searched Keywords

bu00e0n giao (1 second ago.)জেলা প্রশাসকের কার্যালয় নিয়োগ ২০২১ (1 second ago.)strategic business planning (3 seconds ago.)tclassname (3 seconds ago.)jasa backlink web 2.0 (4 seconds ago.)peta jensen6.17k (4 seconds ago.)via de e-mailvoorkeuren (4 seconds ago.)kontakt  (5 seconds ago.)basicsqqmetadataqqkeyqqprimarycategoryqqvalueqqcodeqqbanking-basicsqqnameqqbanking (5 seconds ago.)dpwinj (7 seconds ago.)menawan (8 seconds ago.)бібліотекар 2 дивитись онлайн українською (8 seconds ago.)中央国家机关举报网站 (9 seconds ago.)中远海 蛇口-班加罗尔价 (9 seconds ago.)пицца акапелла (10 seconds ago.)setunevil (11 seconds ago.)white to brown (12 seconds ago.)finding a great supervisor (13 seconds ago.)megapixel (15 seconds ago.)teslim edildi (18 seconds ago.)complete subject (18 seconds ago.)garantili (18 seconds ago.)afreferrer (19 seconds ago.)exhibit  (19 seconds ago.)styrofoam cooler (19 seconds ago.)computer-aided dialing systems (20 seconds ago.)gn bin (21 seconds ago.)may 4, 2014 (22 seconds ago.)研发实力 (22 seconds ago.)ateno (22 seconds ago.)