5lb.ru — купить спортивное питание в Москве. Доставка и самовывоз

Safety: Low trust score
Year Founded: 2007
Global Traffic Rank: 111,595
Estimated Worth: $168,480
Category: Health > Nutrition

Интернет-магазин спортивного питания и витаминов 5lb.ru. Широкий ассортимент, известные производители. Доставка на дом и самовывоз из 61 магазина.



Domain summary

Last updated
2020-10-14
Domain label
5lb
Domain extension
ru
Domain registered:
2007-12-05
Domain updated:
2020-10-14
Domain expires:
2020-12-05
Global Traffic Rank
111,595
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$168,480
Estimated daily income
$234
Estimated monthly income
$7,118

Rank summary

How is 5lb.ru ranked relative to other sites:

Percentage of visits to 5lb.ru from a search engine:


Frequently Asked Questions (FAQ)

Q: When was 5lb.ru registered?
A: 5lb.ru was registered 13 years, 4 months, 1 week, 20 hours, 2 minutes, 42 seconds ago on Wednesday, December 5, 2007.
Q: When was the WHOIS for 5lb.ru last updated?
A: The WHOIS entry was last updated 5 months, 4 weeks, 1 day, 20 hours, 2 minutes, 42 seconds ago on Wednesday, October 14, 2020.
Q: What are 5lb.ru's nameservers?
A: DNS for 5lb.ru is provided by the following nameservers:
  • ns1.ihc.ru
  • ns2.ihc.ru
Q: Who is the registrar for the 5lb.ru domain?
A: The domain has been registered at RU-CENTER-REG-RIPN.
Q: What is the traffic rank for 5lb.ru?
A: 5lb.ru ranks 111,595 globally on Alexa. 5lb.ru has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit 5lb.ru each day?
A: 5lb.ru receives approximately 19,519 visitors and 117,114 page impressions per day.
Q: What IP address does 5lb.ru resolve to?
A: 5lb.ru resolves to the IPv4 address 178.57.218.206.
Q: In what country are 5lb.ru servers located in?
A: 5lb.ru has servers located in the Russia.
Q: What webserver software does 5lb.ru use?
A: 5lb.ru is powered by Nginx/1.10.2 webserver.
Q: Who hosts 5lb.ru?
A: 5lb.ru is hosted by Oversun Ltd in Russia.
Q: How much is 5lb.ru worth?
A: 5lb.ru has an estimated worth of $168,480. An average daily income of approximately $234, which is roughly $7,118 per month.

5lb.ru Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

5lb.ru Free SEO Report

Website Related Search Terms

Website Inpage Analysis for 5lb.ru

H1 Headings

1 :
  1. Магазин спортивного питания и витаминов

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

42 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

138:

Links - Internal (nofollow)

2:

Links - Outbound

8:

Links - Outbound (nofollow)

7:

Keyword Cloud for 5lb.ru

red star labsoptimum nutritionred startrec nutritionomega5lbru2nutrition0wheyoptimumstarlabsstar labstrec1red

Who hosts 5lb.ru?

5lb.ru Hosting Provider Information

Hosted IP Address:178.57.218.206
Hosted Hostname:www.5lb.ru
Service Provider:Oversun Ltd
Hosted Country:RussiaRU
Location Latitude:55.7386
Location Longitude:37.6068
Webserver Software:nginx/1.10.2

Is "Oversun Ltd" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
Oversun Ltd
0.0164%

HTTP Header Analysis for 5lb.ru

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.10.2
Date: Wed, 14 Oct 2020 16:19:37 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Expires: Tue, 13 Oct 2020 16:19:37 GMT
Pragma: no-cache
Content-language: ru
Cache-control: no-cache, no-store, must-revalidate
Content-Encoding: gzip

5lb.ru Domain Nameserver Information

HostIP AddressCountry
ns1.ihc.ru 178.248.237.118
ns2.ihc.ru 95.213.233.218


Need to find out who hosts 5lb.ru?


Domain Registration (WhoIs) information for 5lb.ru

 % By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: 5LB.RU
nserver: ns1.ihc.ru.
nserver: ns2.ihc.ru.
state: REGISTERED, DELEGATED, VERIFIED
person: Private Person
registrar: REGRU-RU
admin-contact: http://www.reg.ru/whois/admin_contact
created: 2007-12-05T21:00:00Z
paid-till: 2020-12-05T21:00:00Z
free-date: 2021-01-06
source: TCI

Last updated on 2020-08-17T20:06:34Z

Websites with Similar Names

5lb.com.ua
Интернет магазин Opencart "Русская сборка"
5lb.ru
5lb.ru — купить спортивное питание в Москве. Доставка и самовывоз
5lb.shop
5lb.ru — купить спортивное питание в Москве. Доставка и самовывоз
5lb.ua
Спортивное питание по низкой цене, продажа в Днепре, доставка по Украине | Магазин спортивного питания 5LB.UA
5lb8f85s.top
click.com.cn
5lbchallenge.com
#5lbChallenge
5lbgj.com
????-????????
5lbj7p.wang
404 - ZK
5lbkv.buzz
没有找到站点

Recently Updated Websites

Explosivecolors.com (1 second ago.)Eyekreate.org (3 seconds ago.)Vibesionlimited.com (4 seconds ago.)Hoabankservics.com (4 seconds ago.)Immunoformula.com (7 seconds ago.)Businesslistsa.co.za (9 seconds ago.)Aa-msa.com (10 seconds ago.)Sellstate95.com (11 seconds ago.)Lookapp.style (12 seconds ago.)Ict-art-connect.eu (12 seconds ago.)Cairomirage.com (13 seconds ago.)Unitederitreanla.com (14 seconds ago.)Sudan-revolution.com (15 seconds ago.)Eliasaccounting.com (16 seconds ago.)Asimoblog.com (16 seconds ago.)Chariot-elevateur.pro (17 seconds ago.)Helpinghandssocietyinc.com (19 seconds ago.)Boterbaik.com (20 seconds ago.)Piratskapartija.com (20 seconds ago.)Matagri40.fr (20 seconds ago.)Mortgageseek.com.au (21 seconds ago.)Lawfirmadvertising.com (21 seconds ago.)Andodeshopping.com (24 seconds ago.)Breaktheillusion.com (24 seconds ago.)Skyjuice.org.au (25 seconds ago.)Kwikneasybonds.com (27 seconds ago.)Investissement-senart-lmnp.com (27 seconds ago.)Rosterpondokpinang.com (27 seconds ago.)Sncg.org.uk (27 seconds ago.)Tolkarportal.com (29 seconds ago.)

Recently Searched Keywords

otázky a odpovědi (1 second ago.)520 settings (2 seconds ago.)sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto (5 seconds ago.)titanium (5 seconds ago.)art directionlinktargetblanktypewixdatapageidbqa6vtargetselftypepagelinkpagenamevivo (6 seconds ago.)jmfleetsales (6 seconds ago.)крым винзавод массандра (7 seconds ago.)seralarda (7 seconds ago.)yaphank sign company (7 seconds ago.)cars (8 seconds ago.)nbsp minolta (8 seconds ago.)дилерский сертификат вниир (9 seconds ago.)electro house nhacdj.vn mới (10 seconds ago.)bacpreview (10 seconds ago.)enucuz (10 seconds ago.)ago5 months ago (12 seconds ago.)guitar player (12 seconds ago.)одеяло лечебное многослойное олм-01 (13 seconds ago.)6v电影网 (14 seconds ago.)important position fixed (15 seconds ago.)continue reading “russischer zupfkuchen”… (16 seconds ago.)santa maria paso (17 seconds ago.)cloud email services (18 seconds ago.)cursos - aulas (20 seconds ago.)акредитација (21 seconds ago.)jackets coats (22 seconds ago.)hope freehub grease (22 seconds ago.)2019 ram 1500 ds oil filter (22 seconds ago.)绩效考核 (24 seconds ago.)windows macopen (25 seconds ago.)