9123.net  |  hao123_???????
Low trust score  | 
hao123???????????????????????????????????????????????????????????????????hao123???

9123.net Website Information

9123.net has a Low Trust Score, a Statvoo Rank of H, an Alexa Rank of 715,288, a Majestic Rank of 0, a Domain Authority of 0% and is not listed in DMOZ.

9123.net is hosted by Comsenz in Beijing, Beijing, China.
9123.net has an IP Address of 119.28.48.228 and a hostname of 119.28.48.228.

The domain 9123.net was registered 1 decade 3 years 8 months ago by , it was last modified 4 years 3 months 3 weeks ago and currently is set to expire 2 years 8 months 1 week ago.


Whois information for 9123.net

Full Whois Lookup for 9123.net Whois Lookup

Domain Name: 9123.NET
Registry Domain ID: 298423501_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2016-10-08T12:09:13Z
Creation Date: 2005-12-26T19:19:05Z
Registry Expiry Date: 2017-12-26T19:19:05Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: F1G1NS1.DNSPOD.NET
Name Server: F1G1NS2.DNSPOD.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-09-07T00:19:49Z

Who hosts 9123.net?

9123.net Web Server Information

Hosted IP Address:119.28.48.228
Hosted Hostname:119.28.48.228
Service Provider:Comsenz
Hosted Country:ChinaCN
Location Latitude:39.9289
Location Longitude:116.3883
Webserver Software:Not Applicable

HTTP Header Analysis for 9123.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: max-age=0
Content-Encoding: gzip
Content-Length: 145271
Content-Type: text/html;charset=UTF-8
Cxy_all: 29065018_156_hao_pg 3a809be0d08ae6a99acb496d1e1e7484
Date: Thu, 03 Mar 2016 23:26:07 GMT
Expires: Thu, 03 Mar 2016 23:26:07 GMT
Lfy: cp01.i0
P3p: CP=" OTI DSP COR IVA OUR IND COM "
Server: BWS/1.0
Sfy: cp01.i0


Need to find out who hosts 9123.net?

9123.net Free SEO Report

Website Inpage Analysis for 9123.net

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for 9123.net

5000notautohide falsedpdatapthisrequiredeferindexherstaticjsbigrenderjsthisrequiredeferindexherstaticjsjqueryjsindexhercontainermoduletoppicturetoppicturejsalogspeedsetl2rautostrict var elslidergridhoverslides210000notautohidestrict alog alogspeedsetpagelet thisrequiredeferindexherstaticjsbigrenderjs functionalogfiremarkvarslidergridaslidernavprevtype l2rautoslidergridslidercontentulsliderslidespoints slidergriddivsliderpaginationnext1 returneventselstyledisplaystrict requiredeferindexherstaticjsadjustjsadjustadjusttnpgfunction eventsdocumentgetelementbyidthisidifrequiredeferindexherstaticjsctrjs function ctrstrict var1requiredeferindexherstaticjsadjustjs functionrequiredeferindexherstaticjsctrjs functionfunction adjusturlrequiredeferindexherstaticjssliderjs function sliderrequiredeferindexherstaticjsprofilejsel5000notautohidesrc0pagelet thisrequiredeferindexherstaticjsbigrenderjsfunctionrenderrenderaddpageletreturnelse elstyledisplaynewnonereturnthisrequiredeferindexherstaticjsbigrenderjs functiondivslidergridgridhovercls slidergridhoverslidesslidergridaslidernavnextprevdivslidergridgridhoverclsrenderaddpageletreturniffadeautoslidergridaslidernavnextprev slidergridaslidernavprevtypevar pageletstrict requiredeferindexherstaticjssliderjsstrict var pageletfadeauto trueintervalctrthisrequiredeferindexherstaticjsbigrenderjs function renderdivslidergridgridhovercls slidergridhoverslides slidergridslidercontentulsliderslidespointstrueinterval 5000notautohide falsevar pagelet thisrequiredeferindexherstaticjsbigrenderjsrequiredeferindexherstaticjssliderjsadjustvar pagelet thisrequiredeferindexherstaticjsbigrenderjsfunctionrenderrenderaddpageletreturndatadatealogfire alogfiremarkslidergridaslidernavnextprev slidergridaslidernavprevtype fadeautoconfigl2rauto trueinterval 10000notautohidestrict requiredeferindexherstaticjsctrjs functionslidergridaslidernavprevtype fadeautothisrequiredeferindexherstaticjsbigrenderjsfunctionrenderrenderaddpageletreturnrequiredeferindexherstaticjsadjustjsalogslidergridaslidernavprevtype fadeauto trueintervalstrict requiredeferindexherstaticjsprofilejsslidergriddivsliderpaginationnextstrict requiredeferindexherstaticjsadjustjs functionsliderelsenonereturn false elsevar el documentgetelementbyidthisidiffunction slider slideralog alogspeedsetslidergridaslidernavprevtype l2rauto trueintervalfalsestrict alogel documentgetelementbyidthisidifnonereturn falseelse iffunction ctrfalse else elstyledisplayfamousbannerfunction sliderrenderdatactrfadeauto trueinterval 5000notautohidepagelet thisrequiredeferindexherstaticjsjqueryjsindexhercontainermoduletoppicturetoppicturejsstrict requiredeferindexherstaticjssliderjs functioninittrueinterval 5000notautohidepagelet thisrequiredeferindexherstaticjsbigrenderjsfunctionrenderrenderaddpageletreturn falsestrictslidergridhoverslides slidergridslidercontentulsliderslidespointsidslidergriddivsliderpaginationnext slidergridaslidernavnextprevfunction rendervar pagelet thisrequiredeferindexherstaticjsjqueryjsindexhercontainermoduletoppicturetoppicturejsslidergriddivsliderpaginationnext slidergridaslidernavnextprev slidergridaslidernavprevtypestrict requiredeferindexherstaticjsctrjsslidergridaslidernavnextprev slidergridaslidernavprevtype l2rauto10000notautohide falseslidergridaslidernavprevtypeelstyledisplay nonereturntnrequiredeferindexherstaticjssliderjs functionpageletdatealogfirerequiredeferindexherstaticjsadjustjs function adjustrequiredeferindexherstaticjsctrjsrender renderaddpageletreturn falsefunction render renderaddpageletreturnl2rauto trueintervaltrueinterval 10000notautohide falselinkrender renderaddpageletreturnrenderaddpageletreturn falseslider slidersliderslidersliderslider sliderfalse elsetrueintervalmenuslidergridslidercontentulsliderslidespoints slidergriddivsliderpaginationnext slidergridaslidernavnextprevthisrequiredeferindexherstaticjsbigrenderjsfunctionrenderrenderaddpageletreturn falsefunctionslidergridhoverslides slidergridslidercontentulsliderslidespoints slidergriddivsliderpaginationnexttrueinterval 10000notautohideelstyledisplay nonereturn falsevar elreturnslidergridslidercontentulsliderslidespointslogslider slider slidersliderpagelet thisrequiredeferindexherstaticjsbigrenderjs

Longtail Keyword Density for 9123.net

KeywordsOccurences
strict var pagelet23
slidergridslidercontentulsliderslidespoints slidergriddivsliderpaginationnext slidergridaslidernav--nextprev11
slidergriddivsliderpaginationnext slidergridaslidernav--nextprev slidergridaslidernav--prevtype11
strict requiredeferindexherstaticjssliderjs function11
slidergrid--hoverslides slidergridslidercontentulsliderslidespoints slidergriddivsliderpaginationnext11
divslidergridgridhovercls slidergrid--hoverslides slidergridslidercontentulsliderslidespoints11
requiredeferindexherstaticjssliderjs function slider11
function slider slider11
slider slider sliderslider11
trueinterval 5000notautohide false6
slidergridaslidernav--prevtype l2rauto trueinterval6
slidergridaslidernav--nextprev slidergridaslidernav--prevtype l2rauto6
var pagelet thisrequiredeferindexherstaticjsbigrenderjs5
slidergridaslidernav--prevtype fadeauto trueinterval5
fadeauto trueinterval 5000notautohide5
slidergridaslidernav--nextprev slidergridaslidernav--prevtype fadeauto5
strict requiredeferindexherstaticjsctrjs function4
render renderaddpageletreturn false4
requiredeferindexherstaticjsctrjs function ctr4
pagelet thisrequiredeferindexherstaticjsbigrenderjs function4
thisrequiredeferindexherstaticjsbigrenderjs function render4
function render renderaddpageletreturn4
var pagelet thisrequiredeferindexherstaticjsjqueryjsindexhercontainermoduletoppicturetoppicturejs4
pagelet thisrequiredeferindexherstaticjsbigrenderjsfunctionrenderrenderaddpageletreturn false3
strict alog alogspeedset3
l2rauto trueinterval 10000notautohide3
trueinterval 10000notautohide false3
var pagelet thisrequiredeferindexherstaticjsbigrenderjsfunctionrenderrenderaddpageletreturn3
false else elstyledisplay3
requiredeferindexherstaticjsadjustjs function adjust3
strict requiredeferindexherstaticjsadjustjs function3
strict var el3
var el documentgetelementbyidthisidif3
elstyledisplay nonereturn false3
nonereturn false else3
strict var28
var pagelet23
function slider12
slidergriddivsliderpaginationnext slidergridaslidernav--nextprev11
slidergridaslidernav--nextprev slidergridaslidernav--prevtype11
slidergridslidercontentulsliderslidespoints slidergriddivsliderpaginationnext11
strict requiredeferindexherstaticjssliderjs11
slidergrid--hoverslides slidergridslidercontentulsliderslidespoints11
requiredeferindexherstaticjssliderjs function11
slider sliderslider11
slider slider11
divslidergridgridhovercls slidergrid--hoverslides11
function events8
trueinterval 5000notautohide7
renderaddpageletreturn false6
5000notautohide false6
slidergridaslidernav--prevtype l2rauto6
l2rauto trueinterval6
function ctr5
pagelet thisrequiredeferindexherstaticjsbigrenderjs5
fadeauto trueinterval5
slidergridaslidernav--prevtype fadeauto5
thisrequiredeferindexherstaticjsbigrenderjs function4
strict requiredeferindexherstaticjsctrjs4
requiredeferindexherstaticjsctrjs function4
function render4
render renderaddpageletreturn4
pagelet thisrequiredeferindexherstaticjsjqueryjsindexhercontainermoduletoppicturetoppicturejs4
function adjust4
strict requiredeferindexherstaticjsprofilejs4
pagelet thisrequiredeferindexherstaticjsbigrenderjsfunctionrenderrenderaddpageletreturn3
else elstyledisplay3
thisrequiredeferindexherstaticjsbigrenderjsfunctionrenderrenderaddpageletreturn false3
trueinterval 10000notautohide3
alog alogspeedset3
datealogfire alogfiremark3
false else3
strict alog3
el documentgetelementbyidthisidif3
10000notautohide false3
-1 return3
else if3
strict requiredeferindexherstaticjsadjustjs3
requiredeferindexherstaticjsadjustjs function3
elstyledisplay nonereturn3
var el3
nonereturn false3
strict98
function81
var52
false23
pagelet23
slider23
if13
slidergrid--hoverslides12
sliderslider12
slidergridaslidernav--prevtype11
trueinterval11
divslidergridgridhovercls11
slidergriddivsliderpaginationnext11
slidergridaslidernav--nextprev11
slidergridslidercontentulsliderslidespoints11
requiredeferindexherstaticjssliderjs11
events10
tn10
09
else8
l2rauto7
5000notautohide7
elstyledisplay6
new6
renderaddpageletreturn6
src6
fadeauto5
ctr5
data5
return5
thisrequiredeferindexherstaticjsbigrenderjs5
alogspeedset5
id5
famousbanner4
data-ctr4
requiredeferindexherstaticjsprofilejs4
dpdatap4
thisrequiredeferindexherstaticjsjqueryjsindexhercontainermoduletoppicturetoppicturejs4
render4
requiredeferindexherstaticjsctrjs4
log4
alog4
init4
adjust4
config4
10000notautohide3
nonereturn3
thisrequiredeferindexherstaticjsbigrenderjsfunctionrenderrenderaddpageletreturn3
link3
url3
13
documentgetelementbyidthisidif3
requiredeferindexherstaticjsadjustjs3
alogfiremark3
tnpg3
datealogfire3
23
adjustadjust3
menu3
el3

What are the nameservers for 9123.net?

9123.net Domain Nameserver Information

HostIP AddressCountry
f1g1ns1.dnspod.net 180.163.19.15China China
f1g1ns2.dnspod.net 111.161.57.81China China

9123.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if 9123.net is a scam?