Aacom.org  |  American Association of Colleges of Osteopathic Medicine - AACOM
Low trust score  | 
Home of the American Association of Colleges of Osteopathic Medicine (AACOM). News and resources about Osteopathic Medical Education. Resources for aspiring doctors and medical school students, faculty and administration, apply to osteopathic medical school.




Aacom.org Website Information

Website Ranks & Scores for Aacom.org

Statvoo Rank Statvoo Rank:F
Alexa Rank Alexa Rank:259,045
Majestic Rank Majestic Rank:132,168
Domain Authority Domain Authority:55%
DMOZ DMOZ Listing:No

Whois information for aacom.org

Full Whois Lookup for Aacom.org Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Aacom.org. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: AACOM.ORG
Registry Domain ID: D198409-LROR
Registrar WHOIS Server:
Registrar URL: http://www.networksolutions.com
Updated Date: 2015-02-14T11:31:27Z
Creation Date: 1995-07-22T04:00:00Z
Registry Expiry Date: 2018-07-21T04:00:00Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C3184403-LROR
Registrant Name: American Assoc College of Ostepathic Medicine
Registrant Organization: American Assoc College of Ostepathic Medicine
Registrant Street: 5550 FRIENDSHIP BLVD STE 310
Registrant Street: Suite 310
Registrant City: Chevy Chase
Registrant State/Province: MD
Registrant Postal Code: 20815-7231
Registrant Country: US
Registrant Phone: +1.3019684175
Registrant Phone Ext:
Registrant Fax: +1.3019684101
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C132561235-LROR
Admin Name: Junhua Liu
Admin Organization: AACOM
Admin Street: 7700 OLD GEORGETOWN RD STE 250 STE 250
Admin Street: Suite 250
Admin City: Bethesda
Admin State/Province: MD
Admin Postal Code: 20814-6100
Admin Country: US
Admin Phone: +1.3019684175
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C132561235-LROR
Tech Name: Junhua Liu
Tech Organization: AACOM
Tech Street: 7700 OLD GEORGETOWN RD STE 250 STE 250
Tech Street: Suite 250
Tech City: Bethesda
Tech State/Province: MD
Tech Postal Code: 20814-6100
Tech Country: US
Tech Phone: +1.3019684175
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: NS71.WORLDNIC.COM
Name Server: NS72.WORLDNIC.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-09-22T22:49:11Z

Who hosts Aacom.org?

Aacom.org is hosted by Rackspace Hosting in Texas, San Antonio, United States, 78218.
Aacom.org has an IP Address of 166.78.92.1 and a hostname of 166.78.92.1.



Aacom.org Web Server Information

Hosted IP Address:166.78.92.1
Hosted Hostname:166.78.92.1
Service Provider:Rackspace Hosting
Hosted Country:United StatesUS
Location Latitude:29.4997
Location Longitude:-98.3992
Webserver Software:Not Applicable
Google Map of 50,12

HTTP Header Analysis for Aacom.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Tue, 28 Jul 2015 13:25:33 GMT
Content-Length: 32970


Need to find out who hosts Aacom.org?

Aacom.org Free SEO Report

Website Inpage Analysis for Aacom.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Aacom.org

elevlocelse iffederal funding opportunitiesaccreditationcenter1hidegme expansion planelevaction click elevlabelclickprimary care physicianfundingcollege informationtraining36strategicosteopathic physicianseepresidents welcomeaacomclick elevlabelmeetingsgetgridsizedowninterprofessional2012 annual meetingoverviewseniorupcominghealthnews and eventsome2011 annualvasinglepublicationspresscareaacommunitiesgme accreditation systemaccreditation systemgrantsfaqsposter presentationscare physiciandiversityfederal fundingschoolinsideresourcesphysician workforcemenufast factsgovernmentstudent enrollmentreleasesserviceresearchers2012 annualnewsletterfalseannual meeting sponsorsplanning2014 annualelevloc hrefmeetingosteopathic medical collegepress releaseseducationannual meetingfunctionpublicsponsorsadvocacypolicy fellowshiposteopathicgridsizedeadlinesosteopathic medicineaacom presidentstimerecentactionrecruiting eventsprimarylearn morenbspbasehrefjoint aacom aodmeva gme expansionaacom researchshortagegraduatemedical student debtcurriculumlegislative issuesstudentva gmeprogramselevaction clicktimelineotherlatestcollege information bookpresentationsfacultymedical schoolmediabookosteopathic medical educatorsinformation bookexpansion2013 annualadvisorshealth policy fellowshipplanning guideaacom presidents welcomemeeting sponsorssingle gme2014 annual conferencepostersgme expansionpresidentsbecomeinside omefinancialgraduatesawards programsifaodmepublic policy agendaminorityyearmedical college informationlatest newsreportscosgppolicy agendaaacom awardsinitiatives7careers at aacomelevcategoryapplicantsforcesjoint aacomrecruitingphysiciancollegescolleges of osteopathicgeneralaacom reportsstudentscollege of osteopathicissuesmorenbspshow2expansion plan2010 annual meetingannual conference sessionsprograms aacomstudent debtpublic policyveteransresizepublic statementsaacom leadershipcareeraacom annualprogramosteopathic studentbecome an osteopathicgmejoining0health policymillisecondswindowinnerwidthinformationstrategic plangeneral admissionwelcomehomestatementsalertsmoremedical educationsystem8osteopathic health policymedical studentsvarosteopathic medical educationfinancial aidnewsfellowshipopportunitieselevactionsessions postersaacom annual conferenceaacom awards programsundefinedapplication deadlinesaacom and aodmeenrollmentundergraduate timelineeventsfactspolicysingle gme accreditationsessionsmedical educatorsspecialtydropwindowresidencyplanmedicalannual conferenceoutstanding4guidefees2011 annual meetingorganizationsadmissiongroupscontactgraduate medicalmatriculantsaacom aodmejointeventrequirementselevlabelhref elseupdatesannualleadershipcareer planningworkforcemedadmission requirementseducatorsinternationalmedia centercollaborativedayinitiativeinterprofessional educationletterscongresscouncilstruescholarshiptime in millisecondswashingtonlearnfellowshipsconferencemedical collegegetdebtcareer planning guideawardshrefarnsteinadministratorsdevelopmenttrackfederalmedicineprimary careannual meeting exhibitorsapplicationaidlegislativeus collegesfunding opportunitieselsegraduate medical educationapplying5exhibitorscareers9curriculardodrop downhref else ifundergraduatescholarshipsdepartmentcollegeusnationalosteopathic healthgme accreditationconference sessionslearn moreposterboardmedical studentplan aacomexecutivemeeting exhibitorsamp2010 annualresearchcongressionalosteopathic medicalaacomasaid and scholarshipsnbspgeneral admission requirementsdo studentjoining forceselevloc href elseagendanational osteopathicfast2013 annual meeting

Longtail Keyword Density for Aacom.org

KeywordsOccurences
osteopathic medical education13
colleges of osteopathic8
gme accreditation system6
single gme accreditation6
college information book5
annual conference sessions5
gme expansion plan5
graduate medical education5
osteopathic medical college5
annual meeting exhibitors4
federal funding opportunities4
2014 annual conference4
medical college information4
osteopathic health policy4
annual meeting sponsors4
va gme expansion4
joint aacom aodme3
2013 annual meeting3
2011 annual meeting3
college of osteopathic3
medical student debt3
careers at aacom3
aacom presidents welcome3
aacom and aodme3
2010 annual meeting3
2012 annual meeting3
elevaction click elevlabel3
aid and scholarships3
career planning guide3
general admission requirements3
become an osteopathic3
href else if3
time in milliseconds3
public policy agenda3
primary care physician3
elevloc href else3
news and events3
osteopathic medical educators3
aacom awards programs3
health policy fellowship3
aacom annual conference3
osteopathic medical27
osteopathic medicine23
medical education20
annual conference16
annual meeting12
financial aid10
public statements8
funding opportunities7
single gme7
accreditation system7
medical students7
drop down7
joint aacom6
gme accreditation6
medical school6
conference sessions6
joining forces5
graduate medical5
expansion plan5
gme expansion5
awards programs5
poster presentations5
career planning5
learn more5
medical college5
information book5
college information5
recruiting events5
medical student5
health policy5
2010 annual4
2012 annual4
2011 annual4
meeting exhibitors4
interprofessional education4
meeting sponsors4
2013 annual4
fast facts4
press releases4
public policy4
href else4
aacom reports4
osteopathic health4
va gme4
2014 annual4
presidents welcome4
do student4
legislative issues4
federal funding4
programs aacom3
student debt3
physician workforce3
learn morenbsp3
strategic plan3
inside ome3
national osteopathic3
aacom presidents3
plan aacom3
aacom leadership3
aacom awards3
application deadlines3
admission requirements3
undergraduate timeline3
planning guide3
osteopathic student3
general admission3
us colleges3
click elevlabel3
elevloc href3
else if3
osteopathic physician3
policy agenda3
primary care3
latest news3
media center3
aacom annual3
sessions posters3
medical educators3
elevaction click3
care physician3
student enrollment3
aacom research3
policy fellowship3
aacom aodme3
osteopathic70
aacom61
medical50
annual28
student28
medicine27
education24
health20
awards17
conference17
gme16
programs16
events15
var15
resources14
advocacy14
students13
meeting13
do13
policy13
college12
public12
national12
colleges11
federal11
information11
learn11
news11
function11
more10
010
financial10
if10
sessions10
reports10
aid10
application10
initiatives9
funding9
faqs9
physician9
statements9
accreditation9
amp9
single9
aacomas8
school8
us8
plan8
sponsors8
exhibitors8
issues8
presentations8
opportunities7
joint7
diversity7
system7
cosgp7
17
drop7
false7
down7
research6
nbsp6
26
care6
presidents6
36
releases6
year6
poster6
true6
46
aodme6
latest6
show6
interprofessional6
enrollment6
aacommunities6
welcome6
graduate5
menu5
development5
ome5
book5
55
updates5
other5
graduates5
expansion5
program5
joining5
forces5
scholarships5
day5
posters5
elevloc5
guide5
65
organizations5
75
planning5
career5
85
publications5
recruiting5
faculty5
href5
undefined5
getgridsize4
elevaction4
click4
elevlabel4
training4
strategic4
workforce4
scholarship4
else4
media4
elevcategory4
requirements4
deadlines4
event4
facts4
fast4
time4
board4
fellowships4
legislative4
department4
center4
initiative4
action4
international4
va4
press4
upcoming4
general4
alerts4
congressional4
advisors4
become4
applicants4
leadership4
applying4
fellowship4
see4
debt4
shortage4
hide4
curriculum4
windowinnerwidth3
gridsize3
recent3
93
basehref3
careers3
get3
residency3
morenbsp3
newsletter3
senior3
contact3
councils3
washington3
overview3
track3
meetings3
educators3
researchers3
government3
administrators3
agenda3
letters3
window3
specialty3
matriculants3
timeline3
undergraduate3
arnstein3
minority3
admission3
congress3
executive3
veterans3
outstanding3
curricular3
collaborative3
home3
milliseconds3
med3
grants3
groups3
resize3
service3
primary3
fees3
inside3

What are the nameservers for aacom.org?

Aacom.org Domain Nameserver Information

HostIP AddressCountry
ns71.worldnic.com 207.204.40.136United States United States
ns72.worldnic.com 207.204.21.136United States United States

Aacom.org DNS Record Analysis DNS Lookup

HostTypeTTLExtra
aacom.orgA7179IP: 166.78.92.1
aacom.orgNS7200Target: ns72.worldnic.com
aacom.orgNS7200Target: ns71.worldnic.com
aacom.orgSOA7200MNAME: NS71.WORLDNIC.COM
RNAME: namehost.WORLDNIC.COM
Serial: 115061722
Refresh: 10800
Retry: 3600
Expire: 604800
aacom.orgMX3600Priority: 10
Target: aacom.org.inbound10.mxlogicmx.net
aacom.orgMX3600Priority: 10
Target: aacom.org.inbound10.mxlogic.net
aacom.orgTXT7200TXT: v=spf1 ip4:54.226.84.168
ip4:54.234.99.140 ip4:54.242.191.242
ip4:23.23.21.214
include:spf.protection.outlook.com ~all
aacom.orgTXT7200TXT: 1k5DbqE8L5adqZZ1yc4vwGKYO0qhmZV8EhYm5Xms
I3OAiaGK/Bto7sHj1iggbByFVcxKnuhDyMt9SLn/
1tAEdA==

Alexa Traffic Rank for Aacom.org


Alexa Search Engine Traffic for Aacom.org