Page not found - Precious Homes

Safety: Low trust score
Year Founded: 16
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet



Domain summary

Last updated
2020-10-06
Domain label
abihomesuk
Domain extension
co.uk
Domain registered:
16-Jul-2007
Domain updated:
16-Jul-2019
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Abihomesuk.co.uk registered?
A: Abihomesuk.co.uk was registered 14 years, 2 weeks, 6 days, 13 hours, 13 minutes, 13 seconds ago on Monday, July 16, 2007.
Q: When was the WHOIS for Abihomesuk.co.uk last updated?
A: The WHOIS entry was last updated 2 years, 2 weeks, 6 days, 13 hours, 13 minutes, 13 seconds ago on Tuesday, July 16, 2019.
Q: What are Abihomesuk.co.uk's nameservers?
A: DNS for Abihomesuk.co.uk is provided by the following nameservers:
  • ns.mainnameserver.com
  • ns2.mainnameserver.com
Q: Who is the registrar for the Abihomesuk.co.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Abihomesuk.co.uk?
A: Abihomesuk.co.uk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Abihomesuk.co.uk each day?
A: Abihomesuk.co.uk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Abihomesuk.co.uk resolve to?
A: Abihomesuk.co.uk resolves to the IPv4 address 79.170.44.120.
Q: In what country are Abihomesuk.co.uk servers located in?
A: Abihomesuk.co.uk has servers located in the United Kingdom.
Q: What webserver software does Abihomesuk.co.uk use?
A: Abihomesuk.co.uk is powered by Apache/2.2.15 (CentOS) webserver.
Q: Who hosts Abihomesuk.co.uk?
A: Abihomesuk.co.uk is hosted by Host Europe GmbH in England, Leeds, United Kingdom, Ls12.
Q: How much is Abihomesuk.co.uk worth?
A: Abihomesuk.co.uk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Abihomesuk.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Abihomesuk.co.uk Free SEO Report

Website Inpage Analysis for Abihomesuk.co.uk

H1 Headings

1 :
  1. page not found

H2 Headings

0 :

H3 Headings

1 :
  1. Award Winning Provider

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

2 :
  1. Get news updates
  2. Connect with us

Total IFRAMEs

0 :

Total Images

27 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-12510261-4

Links - Internal

26:

Links - Internal (nofollow)

0:

Links - Outbound

45:

Links - Outbound (nofollow)

0:

Keyword Cloud for Abihomesuk.co.uk

0 0support workerpathways5pxcontact0zindexworkerpagedoglobalwpadmin wpcfpostrelationshipour supportteamtoolsetgooglemappreviewclosestaddressjoinblockprocesswerightclearfloat0 0 10pxmarginourusprecious0 10pxtoolsetgooglemappreviewclosestaddress widthservice1nonedisplayfloat rightdisplay blockrecruitmentjoin our teamnbspwidth200px floatwidth 100referral processtoolsetgooglemappreviewemailfindreferral10pxnbsp nbsp nbsphomesworkyouleftour teamgeneraltoolsetgooglemaplabel0pxtoolsetgooglemappreview width2supportsupported livingccccare200pxcouldlivingheightteamsprecious homesnbsp nbspb94a48workingsupportedwpadminenquiriestoolsetgooglemapcontainerjoin ourwpcfpostrelationship

Longtail Keyword Density for Abihomesuk.co.uk

KeywordsOccurences
nbsp nbsp nbsp5
join our team3
0 0 10px3
wp-admin wpcf-post-relationship7
nbsp nbsp6
our support5
0 05
0 10px4
width 1004
float right4
supported living4
our team3
support worker3
precious homes3
join our3
referral process3
toolset-google-map-preview width3
200px float3
toolset-google-map-preview-closest-address width3
display block3
wp-admin19
support19
016
our14
width13
right10
we9
wpcf-post-relationship8
us8
float7
toolset-google-map-container7
toolset-google-map-preview7
nbsp7
display6
referral6
team5
find5
contact5
you4
0px4
10px4
none4
pathways4
enquiries4
living4
supported4
14
block3
z-index3
left3
general3
200px3
margin3
clear3
toolset-google-map-preview-closest-address3
5px3
23
ccc3
email3
toolset-google-map-label3
b94a483
height3
working3
recruitment3
do3
global3
care3
could3
service3
homes3
precious3
worker3
join3
work3
process3
teams3
page3

Who hosts Abihomesuk.co.uk?

Abihomesuk.co.uk Hosting Provider Information

Hosted IP Address:79.170.44.120
Hosted Hostname:web120.extendcp.co.uk
Service Provider:Host Europe GmbH
Hosted Country:United KingdomGB
Location Latitude:53.7881
Location Longitude:-1.6008
Webserver Software:Apache/2.2.15 (CentOS)

Is "Host Europe GmbH" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
16.3509%
Unknown
7.9282%
AS-26496-GO-DADDY-COM-LLC
4.2120%
NAMECHEAP-NET
3.4686%
AMAZON-AES
2.5797%
GoDaddy.com, LLC
2.3421%
UNIFIEDLAYER-AS-1
2.2322%
Fara Negar Pardaz Khuzestan
1.8901%
CONFLUENCE-NETWORK-INC
1.6374%
1&1 Internet AG
1.5839%
Host Europe GmbH
1.0675%

HTTP Header Analysis for Abihomesuk.co.uk

Http-Version: 1.1
Status-Code: 404
Status: 404 Not Found
Date: Tue, 06 Oct 2020 23:10:33 GMT
Server: Apache/2.2.15 (CentOS)
X-Powered-By: PHP/5.3.3
Expires: Wed, 11 Jan 1984 05:00:00 GMT
Cache-Control: no-cache, must-revalidate, max-age=0
Pragma: no-cache
Link:; rel="https://api.w.org/"
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Abihomesuk.co.uk Domain Nameserver Information

HostIP AddressCountry
ns.mainnameserver.com 79.170.40.2
ns2.mainnameserver.com 79.170.43.3


Need to find out who hosts Abihomesuk.co.uk?


Domain Registration (WhoIs) information for Abihomesuk.co.uk

 Domain name:
abihomesuk.co.uk

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 19-Jan-2013

Registrar:
Heart Internet Ltd t/a Heart Internet [Tag = HEARTINTERNET]
URL: http://www.heartinternet.co.uk

Relevant dates:
Registered on: 16-Jul-2007
Expiry date: 16-Jul-2021
Last updated: 16-Jul-2019

Registration status:
Registered until expiry date.

Name servers:
ns.mainnameserver.com
ns2.mainnameserver.com

WHOIS lookup made at 17:13:10 10-May-2020

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2020.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Websites with Similar Names

Abiho.net
没有找到站点
Abiho.org
Produit de beauté Bio | Abiho
Abihome.be
Abihome | Châssis - Portes - Vérandas
Abihome.de
Abihome - Abiapp, Abizeitung, Abishirts und mehr
Abihome.space
Sign in · GitLab
Abihomeinspectionscincinnati.com
Home Inspection Cincinnati - Slab To Slate, LLC
Abihomeservices.com
Home Inspections Louisville Kentucky | ABI Home Inspection Services
Abihomesuk.co.uk
Page not found - Precious Homes

Recently Updated Websites

Quantoisseur.com (10 seconds ago.)Lavacamorada.com (12 seconds ago.)Dimitrayogateachertraining.com (17 seconds ago.)Cafeconyerbanyc.com (21 seconds ago.)Rusticlaceevents.com (22 seconds ago.)Nankaibooks.com (23 seconds ago.)Fitnesstravelclub.com (25 seconds ago.)Zahnarzt-flensburg.de (28 seconds ago.)Thewhiteenergyprocess.com (31 seconds ago.)Trucknologyinc.com (31 seconds ago.)Carryontrends.com (31 seconds ago.)Webcenter.no (34 seconds ago.)Wemovewater.today (34 seconds ago.)Dangeruss.solutions (40 seconds ago.)Vaftisi.site (41 seconds ago.)Sachi.email (42 seconds ago.)Onsixdevelopers.com (46 seconds ago.)Tecbau.net (48 seconds ago.)Trakyapeyzaj.com (50 seconds ago.)Maisonmarcellus.com (52 seconds ago.)Delightboston.com (57 seconds ago.)Domesticanfgeneral.com (1 minute 1 second ago.)Leireaguero.com (1 minute 2 seconds ago.)Azcamper.com (1 minute 3 seconds ago.)Bootlegreport.com (1 minute 4 seconds ago.)Bob9856.com (1 minute 6 seconds ago.)Vettamusic.com (1 minute 10 seconds ago.)Finmentoring.com (1 minute 16 seconds ago.)Floretstudia.ru (1 minute 19 seconds ago.)Uniluxsuitesolutions.com (1 minute 20 seconds ago.)

Recently Searched Keywords

november 5th (1 second ago.)kanz sienna yavrulu montessori (1 second ago.)6612 الحلقة 02hanyou no yashahime: sengoku otogizoushi الحلقة 02 مترجم اون لاين (1 second ago.)pierre cardin alessi montessori karyola gri (2 seconds ago.)group policy user (3 seconds ago.)00b72a1 (4 seconds ago.)nicola (4 seconds ago.)style-k3yqzm74navcontainerarrow style-k3yqzm74navcontainersvgcontainer (4 seconds ago.)bresult (5 seconds ago.)pierre cardin lucca bebek odası takımı (5 seconds ago.)yavrulu (7 seconds ago.)pierre cardin bonnie genç odası (8 seconds ago.)dinle (8 seconds ago.)gate automation facility (8 seconds ago.)pierre cardin bonnie bebek odası takımı (8 seconds ago.)eric prydz (10 seconds ago.)ring light (11 seconds ago.)pierre cardin aspendos genç odası (11 seconds ago.)semit (12 seconds ago.)dcw-design-harvest vehicle-listingcard (12 seconds ago.)pierre cardin alessi montessori karyola gri (12 seconds ago.)guinea fowl (13 seconds ago.)котельное и вспомогательное оборудование (13 seconds ago.)http cgicatering.co.uk (14 seconds ago.)boru ağırlık hesaplama cetveli (14 seconds ago.)keller entrümpeln (14 seconds ago.)machino still (14 seconds ago.)philippine (15 seconds ago.)group policy user (15 seconds ago.)glycomod (16 seconds ago.)