Сопровождение бизнеса в Абхазии| партнерство Абхазские проекты

Safety: Low trust score
Year Founded: 2014
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Предлагаем сопровождение бизнеса в Абхазии россиянам. 100% порядочность и надежность. Консультации в Абхазии и Москве. Партнерство "Абхазские проекты" - консалтинг, регистрация предприятий, продажа недвижимости, сотрудничество, совместная деятельность. Обращайтесь!



Domain summary

Last updated
2021-06-28
Domain label
abkhaz-project
Domain extension
ru
Domain registered:
2014-10-03
Domain updated:
2021-06-28
Domain expires:
2021-10-03
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Abkhaz-project.ru registered?
A: Abkhaz-project.ru was registered 7 years, 2 weeks, 1 day, 23 hours, 46 minutes, 13 seconds ago on Friday, October 3, 2014.
Q: When was the WHOIS for Abkhaz-project.ru last updated?
A: The WHOIS entry was last updated 3 months, 2 weeks, 6 days, 23 hours, 46 minutes, 13 seconds ago on Monday, June 28, 2021.
Q: What are Abkhaz-project.ru's nameservers?
A: DNS for Abkhaz-project.ru is provided by the following nameservers:
  • ns2.majordomo.ru
  • ns3.majordomo.ru
  • ns.majordomo.ru
Q: Who is the registrar for the Abkhaz-project.ru domain?
A: The domain has been registered at RU-CENTER-REG-RIPN.
Q: What is the traffic rank for Abkhaz-project.ru?
A: Abkhaz-project.ru has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Abkhaz-project.ru each day?
A: Abkhaz-project.ru receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Abkhaz-project.ru resolve to?
A: Abkhaz-project.ru resolves to the IPv4 address .
Q: In what country are Abkhaz-project.ru servers located in?
A: Abkhaz-project.ru has servers located in the .
Q: What webserver software does Abkhaz-project.ru use?
A: Abkhaz-project.ru is powered by Nginx webserver.
Q: Who hosts Abkhaz-project.ru?
A: Abkhaz-project.ru is hosted by Unknown in .
Q: How much is Abkhaz-project.ru worth?
A: Abkhaz-project.ru has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Abkhaz-project.ru Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Abkhaz-project.ru Free SEO Report

Website Inpage Analysis for Abkhaz-project.ru

H1 Headings

2 :
  1. Сопровождение бизнеса в Абхазии
  2. Сопровождение бизнеса в Абхазии

H2 Headings

7 :
  1. Регистрация юридических лиц и ИП в Абхазии
  2. Мы на связи:
  3. +7 916 181-09-19
  4. Недвижимость в Абхазии для россиян
  5. Бухгалтерские услуги в Абхазии
  6. Последние публикации
  7. Я, Кирилл Базилевский, координатор Партнерства "Абхазские проекты"

H3 Headings

17 :
  1. Регистрация бизнеса
  2. Недвижимость
  3. Бухгалтерские услуги
  4. Регистрация ООО в Абхазии
  5. Регистрация ИП в Абхазии
  6. Купить недвижимость
  7. Консультации по недвижимости
  8. Подбор участков
  9. Бухгалтерский консалтинг
  10. Аутсорсинг бухгалтерии
  11. Настройка и поддержка 1С
  12. Участок в Кындыге под мини-гостиницу
  13. Когда созревают фрукты в Абхазии
  14. Недвижимость под дом отдыха на Гумисте
  15. Как россиянину купить автомобиль в Абхазии
  16. Как недвижимость в Абхазии купить россиянам
  17. Как прошел в Сухуме VIII Абхазо-российский деловой форум

H4 Headings

4 :
  1. Follow us on Instagram @abkhaz_project
  2. ПОПУЛЯРНЫЕ СООБЩЕНИЯ
  3. Yandex.Metrika
  4. ПОПУЛЯРНАЯ КАТЕГОРИЯ

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

22 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-133674658-1

Links - Internal

86:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Abkhaz-project.ru

1functionifitemvardisplayarrsplitsiwrapperimagejqueryobjnonetdbackstritem4display nonenewlinkwhatsappjqueryvalueattrhref171 187arrlength2chatbro36undefinedtypeof0jquerynewasync5imagejqueryobjchatsshareismobilewa

Who hosts Abkhaz-project.ru?

Abkhaz-project.ru Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:nginx

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
15.4249%
Unknown
11.7059%
AS-26496-GO-DADDY-COM-LLC
4.1307%
NAMECHEAP-NET
3.3122%
AMAZON-AES
2.5118%
GoDaddy.com, LLC
2.1535%
UNIFIEDLAYER-AS-1
2.1315%
Fara Negar Pardaz Khuzestan
1.7839%
CONFLUENCE-NETWORK-INC
1.5636%
1&1 Internet AG
1.4878%

HTTP Header Analysis for Abkhaz-project.ru

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Mon, 28 Jun 2021 00:37:24 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 42752
Connection: keep-alive
Link:; rel=shortlink
Vary: Accept-Encoding
Content-Encoding: gzip

Abkhaz-project.ru Domain Nameserver Information

HostIP AddressCountry
ns2.majordomo.ru 78.108.88.164
ns3.majordomo.ru 78.108.80.90
ns.majordomo.ru 78.108.80.80


Need to find out who hosts Abkhaz-project.ru?


Domain Registration (WhoIs) information for Abkhaz-project.ru

 % By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: ABKHAZ-PROJECT.RU
nserver: ns2.majordomo.ru.
nserver: ns3.majordomo.ru.
nserver: ns.majordomo.ru.
state: REGISTERED, DELEGATED, VERIFIED
person: Private Person
registrar: R01-RU
admin-contact: https://partner.r01.ru/contact_admin.khtml
created: 2014-10-03T07:54:05Z
paid-till: 2021-10-03T08:54:05Z
free-date: 2021-11-03
source: TCI

Last updated on 2021-06-28T00:36:30Z

Websites with Similar Names

Abkhadbmwa.cam
abkhadbmwa.cam - Registered at Namecheap.com
Abkhan-co.com
Abkhan | مهندسين مشاور آبخوان
Abkhanfilms.com
ABKhanfilms
Abkhangnguyen.com
NÔNG SINH KHANG NGUYÊN
Abkhareedlow.com
abKhareedLOW
Abkhasiabionomical.club
Abkhasiabionomical.club is for sale!
Abkhatikmahasabhapushkar.com
abkhatikmahasabhapushkar.com |
Abkhaz-auto.ru
Абхазия. Абхаз Авто | Продажа авто и недвижимости в Абхазии
Abkhaz-project.ru
Сопровождение бизнеса в Абхазии| партнерство Абхазские проекты

Recently Updated Websites

Eatduedates.us (2 seconds ago.)Cookingthinks.com (3 seconds ago.)Headova.com (5 seconds ago.)Unity-cargo.com (5 seconds ago.)Mariusdahl.com (5 seconds ago.)Romanceinmarriage.com (6 seconds ago.)Driplighting.com (6 seconds ago.)Ups-estore.com (9 seconds ago.)Debconf.org (10 seconds ago.)Asklawyers4justice.com (12 seconds ago.)Beautysocks.com (12 seconds ago.)Jasonwhaling.com (12 seconds ago.)Mytrafficnetwork.com (13 seconds ago.)Detectthings.com (14 seconds ago.)Liamwillington.com (14 seconds ago.)Montanaflyfishingmagazine.com (14 seconds ago.)Manpower-rv.com (15 seconds ago.)Pi-mak.com (15 seconds ago.)Cleangolfproduct.com (16 seconds ago.)Mapletracecommunity.com (17 seconds ago.)Alicantepartners.llc (17 seconds ago.)Jonathancandesign.com (17 seconds ago.)School-library.com.ua (18 seconds ago.)Valuationwestfargo.com (19 seconds ago.)P3m-academy.com (19 seconds ago.)Nthcommerce.com (20 seconds ago.)Lime-tyger.com (20 seconds ago.)Huohuvip4767.com (20 seconds ago.)Minecraft-ip.ru (20 seconds ago.)Psycho.pro (22 seconds ago.)

Recently Searched Keywords

maison hautes pyrenees (4 seconds ago.)islamic media (5 seconds ago.)cooked homemade dog food (6 seconds ago.)рѕ рѕр°сѓ (6 seconds ago.)beeg.com (6 seconds ago.)jav free (6 seconds ago.)no interest (7 seconds ago.)1939 dodge coupe for sale (7 seconds ago.)el grupo inmobiliario best house ofrece a sus franquiciados una fórmula única de formación inicial y continua ilimitada tanto para los directores (7 seconds ago.)game guide (8 seconds ago.)issues please (8 seconds ago.)болгарка (10 seconds ago.)scarpe stringate (11 seconds ago.)мотокультиваторы бензиновые (12 seconds ago.)communication plan template ppt free (12 seconds ago.)accounting system (12 seconds ago.)s bi vit (12 seconds ago.)chipsets (13 seconds ago.)commercio elettronico indiretto (13 seconds ago.)motogp schedule 2019 (14 seconds ago.)conducteur pl spl (14 seconds ago.)colright (15 seconds ago.)intelligently (17 seconds ago.)como portuguese (17 seconds ago.)аксессуары к печам (20 seconds ago.)commercio elettronico codice ateco (21 seconds ago.)сварочный инвертор (22 seconds ago.)садовые пылесосы (23 seconds ago.)cohnreznick capital (24 seconds ago.)b11623important bingc-passive (24 seconds ago.)