Abortionconversationproject.org

Website Thumbnail
Checking...
Abortion Conversation Projects

Safety: Low trust score
Year Founded: 2015
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-24
Category: This site has not been categorized yet

Talking about abortion. Abortion Conversation Projects is committed to eliminating the stigma of abortion by supporting individuals and small groups engaged in innovative community-based projects that create new ways and opportunities to talk about abortion honestly and publicly. We provide grants to support projects that talk about abor...


Domain summary

Domain label
abortionconversationproject
Domain extension
org
Domain registered:
2015-06-23
Domain updated:
2020-10-24
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is abortionconversationproject.org ranked relative to other sites:

Percentage of visits to abortionconversationproject.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Abortionconversationproject.org registered?
A: Abortionconversationproject.org was registered 5 years, 5 months, 1 week, 3 days, 14 hours, 12 minutes, 7 seconds ago on Tuesday, June 23, 2015.
Q: When was the WHOIS for Abortionconversationproject.org last updated?
A: The WHOIS entry was last updated 1 month, 1 week, 3 days, 14 hours, 12 minutes, 7 seconds ago on Saturday, October 24, 2020.
Q: What are Abortionconversationproject.org's nameservers?
A: DNS for Abortionconversationproject.org is provided by the following nameservers:
  • ns49.domaincontrol.com
  • ns50.domaincontrol.com
Q: Who is the registrar for the Abortionconversationproject.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Abortionconversationproject.org?
A: Abortionconversationproject.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Abortionconversationproject.org each day?
A: Abortionconversationproject.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Abortionconversationproject.org resolve to?
A: Abortionconversationproject.org resolves to the IPv4 address 184.168.131.241.
Q: In what country are Abortionconversationproject.org servers located in?
A: Abortionconversationproject.org has servers located in the United States.
Q: What webserver software does Abortionconversationproject.org use?
A: Abortionconversationproject.org is powered by Squarespace webserver.
Q: Who hosts Abortionconversationproject.org?
A: Abortionconversationproject.org is hosted by GoDaddy.com, LLC in Arizona, Scottsdale, United States, 85260.
Q: How much is Abortionconversationproject.org worth?
A: Abortionconversationproject.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Abortionconversationproject.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Abortionconversationproject.org Free SEO Report

Website Inpage Analysis for Abortionconversationproject.org

H1 Headings

2 :
  1. We fund stigma-busting ideas
  2. Read the latest on our blog!

H2 Headings

1 :
  1. Subscribe to our newsletter...

H3 Headings

5 :
  1. Abortion Conversation Projects is committed to eliminating the stigma of abortion.  
  2. We seek opportunities to work in close partnership to offer helpful webinars, trainings and workshops that support collaborative Stigma-Busting projects.  ACP designs, collaborates and supports individuals and small groups engaged in innovative community-based projects that create new ways and opportunities to talk about abortion honestly and publicly.
  3. We are building a stigma-busting community! Join us!
  4. Learn more about ACP.
  5. Here are a few of our Grant Partners. Meet everyone here . 

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

32 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-64270043-1

Links - Internal

38:
  1. Abortionconversationproject Mission and Vision
    http://abortionconversationproject.org/mission-and-vision
  2. Abortionconversationproject Our History
    http://abortionconversationproject.org/our-history
  3. Abortionconversationproject About Us
    http://abortionconversationproject.org/about-us
  4. Abortionconversationproject Annual Report
    http://abortionconversationproject.org/annual-report
  5. Abortionconversationproject Our Grant and Project Partners
    http://abortionconversationproject.org/grant-and-project-partners
  6. Abortionconversationproject Apply for a Grant or Project Partnership
    http://abortionconversationproject.org/apply-for-a-project-partnership
  7. Abortionconversationproject Project Partner Toolkit
    http://abortionconversationproject.org/toolkit
  8. Abortionconversationproject Abortion
    http://abortionconversationproject.org/abortion
  9. Abortionconversationproject Conversations
    http://abortionconversationproject.org/conversations
  10. Abortionconversationproject Storytelling
    http://abortionconversationproject.org/storytelling
  11. Abortionconversationproject Stigma
    http://abortionconversationproject.org/stigma
  12. Abortionconversationproject Men and Abortion
    http://abortionconversationproject.org/men-and-abortion
  13. Abortionconversationproject Showcase
    http://abortionconversationproject.org/showcase
  14. Abortionconversationproject Blog
    http://abortionconversationproject.org/blog
  15. Abortionconversationproject Donate
    http://abortionconversationproject.org/donate
  16. Abortionconversationproject Newsletter
    http://abortionconversationproject.org/newsletter
  17. Abortionconversationproject Contact Us
    http://abortionconversationproject.org/contact
  18. Abortionconversationproject Amazon Smile
    http://abortionconversationproject.org/amazon-smile
  19. http://abortionconversationproject.org/
    http://abortionconversationproject.org/
  20. Abortionconversationproject Learn more about ACP.
    http://www.abortionconversationproject.org/mission-and-vision/
  21. Abortionconversationproject here
    http://abortionconversationproject.org/grants
  22. http://abortionconversationproject.org/blog/2020/9/5/six-innovative-projects-chosen-for-2020
    http://abortionconversationproject.org/blog/2020/9/5/six-innovative-projects-chosen-for-2020
  23. Abortionconversationproject Six Innovative Projects Chosen for 2020
    http://abortionconversationproject.org/blog/2020/9/5/six-innovative-projects-chosen-for-2020
  24. Abortionconversationproject Read More →
    http://abortionconversationproject.org/blog/2020/9/5/six-innovative-projects-chosen-for-2020
  25. http://abortionconversationproject.org/blog/2020/7/19/black-lives-matter
    http://abortionconversationproject.org/blog/2020/7/19/black-lives-matter
  26. Abortionconversationproject Black Lives Matter
    http://abortionconversationproject.org/blog/2020/7/19/black-lives-matter
  27. Abortionconversationproject Read More →
    http://abortionconversationproject.org/blog/2020/7/19/black-lives-matter
  28. Abortionconversationproject Thurston's Vision: De-Stigmatizing More Than One Abortion
    http://abortionconversationproject.org/blog/2020/3/16/thurstons-vision-de-stigmatizing-more-than-one-abortion
  29. Abortionconversationproject Read More →
    http://abortionconversationproject.org/blog/2020/3/16/thurstons-vision-de-stigmatizing-more-than-one-abortion
  30. http://abortionconversationproject.org/blog/2020/1/31/abortion-stigma-busting-in-virtual-reality-change-that-is-already-happening
    http://abortionconversationproject.org/blog/2020/1/31/abortion-stigma-busting-in-virtual-reality-change-that-is-already-happening
  31. Abortionconversationproject Abortion Stigma Busting in Virtual Reality: Change That is Already Happening
    http://abortionconversationproject.org/blog/2020/1/31/abortion-stigma-busting-in-virtual-reality-change-that-is-already-happening
  32. Abortionconversationproject Read More →
    http://abortionconversationproject.org/blog/2020/1/31/abortion-stigma-busting-in-virtual-reality-change-that-is-already-happening
  33. Abortionconversationproject Join Us
    http://abortionconversationproject.org/newsletter
  34. Abortionconversationproject Home
    http://abortionconversationproject.org/home
  35. Abortionconversationproject About
    http://abortionconversationproject.org/mission-and-vision
  36. Abortionconversationproject Grants
    http://abortionconversationproject.org/our-grantees
  37. Abortionconversationproject Resources
    http://abortionconversationproject.org/abortion
  38. Abortionconversationproject Join us
    http://abortionconversationproject.org/newsletter

Links - Internal (nofollow)

0:

Links - Outbound

4:

Links - Outbound (nofollow)

0:

Keyword Cloud for Abortionconversationproject.org

join us donatedonateinnovativejan 31 2020conversation3our grant2joinmore 8594usread more 8594projectsshowcasemar 16 2020grantsmoresepsep 5us donate5 2020readresourcesstigmaprojectabortionjan 31janmissionjulread more2020 readpartnersconversation projectsgrantjul 19partnership2020 read moremar 160join usjul 19 2020ourshowcase blog4marblogblog join31 2020visionnewsletter16 202019 2020sep 5 2020smallshowcase blog join15blog join us

Who hosts Abortionconversationproject.org?

Abortionconversationproject.org Hosting Provider Information

Hosted IP Address:184.168.131.241
Hosted Hostname:ip-184-168-131-241.ip.secureserver.net
Service Provider:GoDaddy.com, LLC
Hosted Country:United StatesUS
Location Latitude:33.6013
Location Longitude:-111.8867
Webserver Software:Squarespace

Is "GoDaddy.com, LLC" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%

HTTP Header Analysis for Abortionconversationproject.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
date: Sat, 24 Oct 2020 00:53:42 GMT
expires: Thu, 01 Jan 1970 00:00:00 GMT
x-content-type-options: nosniff
content-type: text/html;charset=utf-8
content-encoding: gzip
etag: W/"0625381753a26476e1f15d930f91dc52"
content-length: 17763
Vary: Accept-Encoding
Age: 41869
Accept-Ranges: bytes
x-contextid: rOGWObCw/YMvwuZt1
server: Squarespace

Abortionconversationproject.org Domain Nameserver Information

HostIP AddressCountry
ns49.domaincontrol.com 97.74.104.25
ns50.domaincontrol.com 173.201.72.25


Need to find out who hosts Abortionconversationproject.org?


Domain Registration (WhoIs) information for Abortionconversationproject.org

 Domain Name: ABORTIONCONVERSATIONPROJECT.ORG
Registry Domain ID: D176643894-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.whois.godaddy.com
Updated Date: 2020-08-20T12:02:31Z
Creation Date: 2015-06-23T19:11:08Z
Registry Expiry Date: 2025-06-23T19:11:08Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: Domains By Proxy, LLC
Registrant State/Province: Arizona
Registrant Country: US
Name Server: NS49.DOMAINCONTROL.COM
Name Server: NS50.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-10-24T12:30:32Z

Websites with Similar Names

Abort-accolade.xyz
404 Not Found
Abort-accusation.xyz
???????????????????? ???????????50???...
Abort-dais.xyz
404 Not Found
Abort-early.xyz
abort-early.xyz – ??????????.com??????????
Abort-earnest.xyz
?????????????????? ???????? ??28?????...
Abort-faculty.xyz
abort-faculty.xyz – ??????????.com??????????
Abort-fare.xyz
???????????? ??23???????4?????4???????...
Abort-gender.xyz
?????????????????????? ????????????→...

Recently Updated Websites

Lyfteventmanagement.com (4 seconds ago.)Macaoterritory.com (6 seconds ago.)Northwestymm.com (8 seconds ago.)Maximillianstudio.com (9 seconds ago.)Norsefightinggalla.com (10 seconds ago.)Northcarolinafriendsofsanta.com (13 seconds ago.)Maxmog.com (14 seconds ago.)Marathontrader.com (17 seconds ago.)Marquesitasalguacil.com (17 seconds ago.)Lezamaelitefitness.com (20 seconds ago.)Orretbloggen.com (25 seconds ago.)Luciddreamhotel.com (25 seconds ago.)Oishii-hokkaido.com (28 seconds ago.)Mariaemiliaecelio.com (29 seconds ago.)Nutritiondietcheck.com (31 seconds ago.)Mediacity247.com (32 seconds ago.)Njcheery.com (33 seconds ago.)Nical-design.com (38 seconds ago.)Laojieni.com (38 seconds ago.)Nutzkraut.com (40 seconds ago.)Ombreholding.com (40 seconds ago.)Mariandiaz.com (42 seconds ago.)M0907aaa.com (47 seconds ago.)Madimaedesigns.com (47 seconds ago.)Matthewkagitwong.com (48 seconds ago.)Mansonhome.com (49 seconds ago.)Marisagregory.com (49 seconds ago.)Master-safe.com (50 seconds ago.)Officemailnetwork.com (52 seconds ago.)Maekmesh.com (52 seconds ago.)

Recently Searched Keywords

krty (1 second ago.)cover photo (1 second ago.)talan : envie de changer de terrain de jeux à la rentrée (1 second ago.)cuisine and exemplary (2 seconds ago.)exemplary (2 seconds ago.)gt bronx brooklyn (2 seconds ago.)jis (3 seconds ago.)lilly garden (3 seconds ago.)zabardast (4 seconds ago.)midwives join our (4 seconds ago.)cocke (4 seconds ago.)style-k41f2zs2label (5 seconds ago.)border-radius 4px media (5 seconds ago.)baad (5 seconds ago.)style-k403znvh2navcontainercenter-direction (6 seconds ago.)die gesamtsumme (6 seconds ago.)innerhalb von 4 (6 seconds ago.)best keywords research tools for seo (7 seconds ago.)bacon tomatoes rice (8 seconds ago.)deciduous definition (8 seconds ago.)die registrierung kann (8 seconds ago.)yorkarea (9 seconds ago.)color060606word-breakbreak-worddisplayinline-blockline-height1 (9 seconds ago.)facebook cover photo (9 seconds ago.)journey within (10 seconds ago.)interview with ct for sale (10 seconds ago.)100110us (10 seconds ago.)how to design facebook cover in photoshop (11 seconds ago.)sas aide natureserve à protéger la biodiversité à l’aide de l’intelligence artificielle (11 seconds ago.)pldoyerhttpswwwktippchfileadmintemplatesfaviconplaedoyerapple-icon-180x180pngweiternbsp bcher (12 seconds ago.)