|  American Camp Association
Low trust score  | Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:F
Alexa Rank Alexa Rank:278,131
Majestic Rank Majestic Rank:42,236
Domain Authority Domain Authority:76%
DMOZ DMOZ Listing:Yes

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Registry Domain ID: D2461067-LROR
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2016-08-18T18:34:36Z
Creation Date: 1998-11-18T05:00:00Z
Registry Expiry Date: 2017-11-17T05:00:00Z
Registrar Registration Expiration Date:
Registrar: Tucows Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
Registry Registrant ID: C145338667-LROR
Registrant Name: Contact Privacy Inc. Customer 016153110
Registrant Organization: Contact Privacy Inc. Customer 016153110
Registrant Street: 96 Mowat Ave
Registrant City: Toronto
Registrant State/Province: ON
Registrant Postal Code: M6K3M1
Registrant Country: CA
Registrant Phone: +1.4165385457
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C145338667-LROR
Admin Name: Contact Privacy Inc. Customer 016153110
Admin Organization: Contact Privacy Inc. Customer 016153110
Admin Street: 96 Mowat Ave
Admin City: Toronto
Admin State/Province: ON
Admin Postal Code: M6K3M1
Admin Country: CA
Admin Phone: +1.4165385457
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C145338667-LROR
Tech Name: Contact Privacy Inc. Customer 016153110
Tech Organization: Contact Privacy Inc. Customer 016153110
Tech Street: 96 Mowat Ave
Tech City: Toronto
Tech State/Province: ON
Tech Postal Code: M6K3M1
Tech Country: CA
Tech Phone: +1.4165385457
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Name Server: NS2.HOVER.COM
Name Server: NS3.HOVER.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of WHOIS database: 2017-08-28T03:37:08Z

Who hosts is hosted by Google Inc. in California, Mountain View, United States, 94043. has an IP Address of and a hostname of Web Server Information

Hosted IP Address:
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.419
Location Longitude:-122.058
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 31 May 2015 17:28:32 GMT
Server: Apache
Last-Modified: Sun, 31 May 2015 15:54:47 GMT
ETag: "3bc559176cc03a5d1d979f87ea372442"
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Cache-Control: must-revalidate
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

experienceusstart searchyoutubeyourtwitter linkedin youtubesoyour childfind a campcamphelpchildrenfindchildlinkedinworldamericanparentsfind the rightpartnersprogramsyoucampcampallacagoogleplusbecauseviewfamiliesright campfunbusinessassociationsearchmuch morefind a campfacebookcampcamp is funmore letacamembershiptwitter linkedinso muchchild start searchampcamp associationaccreditationmuchourchild startrightletaca helplinkedin youtubemore0american camp associationamerican campfun and sojoincommunityhelp youstaytwitternewshelp you findstartmuch more letacafacebook twitter linkedinlocalprofessionalslearn moreresourcescampersgetletaca help youyou findcampers ampfacebook twitterso much morecamp for yourletacacamp newsmore letaca helplearnjobdevelopmentyour child startcamp

Longtail Keyword Density for

american camp association4
help you find3
letaca help you3
find the right3
your child start3
child start search3
more letaca help3
camp for your3
much more letaca3
twitter linkedin youtube3
facebook twitter linkedin3
find a campcamp3
campcamp is fun3
so much more3
fun and so3
find a camp3
learn more11
camp association5
help you4
you find4
much more4
american camp4
your child3
start search3
camp news3
right camp3
child start3
more letaca3
twitter linkedin3
facebook twitter3
linkedin youtube3
campers amp3
so much3
letaca help3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Canada Canada Canada Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?