Domain summary

Last updated
2021-03-28
Domain label
acgme
Domain extension
org
Global Traffic Rank
77,921
Statvoo Rating
E
Trust Score
Low Trust Score
Estimated worth
$200,880
Estimated daily income
$279
Estimated monthly income
$8,486

Frequently Asked Questions (FAQ)

Q: When was Acgme.org registered?
A: Acgme.org was registered 2 months, 3 weeks, 3 days, 13 hours, 52 minutes, 45 seconds ago on Sunday, March 28, 2021.
Q: When was the WHOIS for Acgme.org last updated?
A: The WHOIS entry was last updated 2 months, 3 weeks, 3 days, 13 hours, 52 minutes, 45 seconds ago on Sunday, March 28, 2021.
Q: What are Acgme.org's nameservers?
A: DNS for Acgme.org is provided by the following nameservers:
  • ns1.acgme.org
  • ns2.acgme.org
Q: Who is the registrar for the Acgme.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Acgme.org?
A: Acgme.org ranks 77,921 globally on Alexa. Acgme.org has a Low Trust Score, and a Statvoo Rank of E.
Q: How many people visit Acgme.org each day?
A: Acgme.org receives approximately 23,275 visitors and 139,650 page impressions per day.
Q: What IP address does Acgme.org resolve to?
A: Acgme.org resolves to the IPv4 address 63.84.4.100.
Q: In what country are Acgme.org servers located in?
A: Acgme.org has servers located in the United States.
Q: What webserver software does Acgme.org use?
A: Acgme.org is powered by webserver.
Q: Who hosts Acgme.org?
A: Acgme.org is hosted by MCI Communications Services, Inc. d/b/a Verizon Business in Tennessee, United States.
Q: How much is Acgme.org worth?
A: Acgme.org has an estimated worth of $200,880. An average daily income of approximately $279, which is roughly $8,486 per month.

Acgme.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Acgme.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Acgme.org

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

8 :
  1. ACGME Names Award for Barbara Ross-Lee, DO
  2. Transition to Residency Toolkit Available
  3. Nominations Open! 2022 ACGME Awards
  4. Thank You for Joining Us!
  5. ACGME Names Award for Barbara Ross-Lee, DO
  6. Transition to Residency Toolkit Available
  7. Nominations Open! 2022 ACGME Awards
  8. Thank You for Joining Us!

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

32 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

151:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Acgme.org

osteopathicfunctionresult finalrsvpprocessresult moduleidpoliciesacgmecache true datavar divhtmlshowdivflowplayerwithlightboxpopupdivid overlaydividoutstandingformmastertaburl if datahasownpropertyddata paramsjquerypfscrollelementscrolltop jquerydivoverlaydivstyledisplay none trysetadtcookietemplatename alerttemplatenamedocumentgetelementbyidpopupdivid var overlaydivoverlaydivstyledisplay blockmaterials acgme responsetry ifjqueryhtmltype postpfviewtop 0 varfunction esponsoringjqueryparsejsondatafunction bookmarkclickrefitemid pfviewtopimageurl norepeatalerttemplatename setcookiearticledetailtemplatetemplatename1pandemicmedicineurl imageurl norepeatdesktopmodulespackflashpublisharticlelistcontrolsgettabarticlesaspxprocessrsvpclickcatch errorjquerytpnvmnerrorisrsvpwithformmasterformmastertaburl returnnull overlaydivstyledisplay blockpfviewtop jquerypfscrollelementscrolltopfunction getcookiecname ifpopupvar pfissafari falsecontentfunctionresult finalrsvpprocessresultcase log systemmanually2 rsvpbtnvalue rsvpbuttontextisrsvpwithformmaster formmastertaburl varnone if overlaydivannual educationalprogram requirements0 var pfissafariimageurl ifimageurl var divsplashclassmoduleid imageurlif imageurl varpfviewtop jquerypfscrollelementscrolltop jquerydivgraduate medicaljson success functionresultfunctionresultpfviewtop 0divsplashclass documentgetelementbyiddivsplashclass moduleidrefitemidoffsettop functioncstartcstarticonxalertexdatetogmtstringalertexpiredays documentcookiecname valueannual educational conferencecommunityrefitemidshow jquerypfscrollelementscrolltopjquerypfitemresourceblock functionpfissafarirsvpbuttontext rsvpbtnclassname rsvpbuttonclinical learningmanually and closevar targeturl desktopmodulespackflashpublisharticlelistcontrolsgettabarticlesaspxprocessrsvpclickeventid userid portalidondemand contentalertexdatetogmtstringalertexpiredays documentcookiecnamedate exdatesetdateexdategetdateexpiredayserror alerttherereturntobookmarkrefitemid jquerydiv refitemidhidefieldjquerybravosearchinput1 2021moduleidvideoid vardivsplashclassinnerhtml1 var divhtmljqueryhtml ifpfissafarilearning environmentall ondemand contentjquerydiv refitemidhidethrough juneif imageurljgmereturnpopupdivinnerhtml popupdivinnerhtmlcommitteeflowplayerissplash backgroundcouncilnowjquerylistvideopopupleadershippost cacheaccessvar overlaydiv documentgetelementbyidoverlaydividif cend1 cenddocumentcookielengthrelated materials acgmesiteeducational conferenceeventid rsvpbuttontext rsvpedbuttontextdataresultrsvpbtnsetattributeonclick javascriptlocationhrefamericanfalse var pfscrollelementcstartdocumentcookieindexofcname ifapplicationjson charsetutf8 datatypeif popupdivrsvpedbuttontext isrsvpwithformmaster formmastertaburlexdatesetdateexdategetdateexpiredays alertexdatetogmtstringalertexpiredays documentcookiecnamepandemic crisis getvar divsplashclass documentgetelementbyiddivsplashclassinstitutionalelse player moduleidunescapedocumentcookiesubstringcstartcend return functionjquerythissiblingsshadowapril 28 2021displaystartdocumentgetelementbyidoverlaydivid if popupdivjson successdatad data jqueryparsejsondatatheirurljune 1 2021overlaydiv null overlaydivstyledisplayrsvpedbuttontext isrsvpwithformmasterformmastertaburlif datahasownpropertydoutstanding workrsvpbtnvalue processrsvpedbuttondocumentgetelementbyidpopupdivid varallcache truelogeventid eventid useridstoppingpopupdivstyledisplaymoduleid ifresidencyrossleeeventidbook mark functionsdatatypebookmarkclickrefitemid pfviewtop jquerypfscrollelementscrolltopagainbarbara rosslee doother0backgroundpositioncenter backgroundsize 100cstartdocumentcookieindexofcnameinitiatives7refitemidhide pfviewtop jquerypfscrollelementscrolltoppfviewtopif overlaydivhelpreturntobookmarkrefitemidprogramfalse functionjquerylistvideopopup moduleidchildrenappendtobodyselfstudypopupdivstyledisplay block ifpfviewtop jquerypfscrollelementscrolltoppfviewtopalertgetcookiearticledetailtemplate functionimageurl norepeat backgroundpositioncentervideoidremove attridplayerdatajquerydivmoduleid eventid5wednesday apriltransitioncrisistryoverlaydivid moduleidperiodic4moduleid eventid eventidtransition to residencynone try ifcenddocumentcookieindexofcstartinstitutional officialscommon programvideo manuallyiconsearchcssdisplay blockurl targeturlvar targeturlrsvpbtnvalue rsvpbuttontexthealth carecallif divsplashclass nulluserid portalid rsvpbuttontextpolicies and relatedconference now throughif rsvpbtn nullrsvpbtnvalue rsvpedbuttontext rsvpbtnclassnamerefitemidshow jquerypfscrollelementscrolltopjquerypfitem refitemidoffsettopjqueryhtml ifpfissafari pfscrollelementisrsvpwithformmaster rsvpbtnsetattributeonclickdocumentgetelementbyiddivsplashclass moduleidmedical education communityrsvpedbuttontext rsvpbtnclassnameeventid if rsvpbtnfinalrsvpprocessdataspecialtyeventid ifmoduleidchildrenappendtobodyformmastertaburl varvar divhtml popupdivinnerhtmlexpiresexdatetogmtstringpath function getcookiecnamegme accreditation systemexdatesetdateexdategetdateexpiredaysbedsidesetcookiearticledetailtemplatetemplatename1 alertgetcookiearticledetailtemplate functionportalid rsvpbuttontext rsvpedbuttontextpopupdivstyledisplay none100 jquerylistvideopopup moduleidchildrenappendtobodyif popupdividindexofembedrsvpbtnsetattributeonclicknull rsvpbtnvalueeducation learndocumentcookiecname value expiredaysnullcatch error alerttherehours minutesalertthere6function setadtcookietemplatenameimageurl if imageurlnorepeat backgroundpositioncenterdocumentgetelementbyidrsvp moduleidclerstopping videoplease clickinternationalparams urlvalue expiredaysnull expiresexdatetogmtstringpathoverlaydivstyledisplay noneblock if overlaydivgetfinalrsvpprocessresultsingle gme accreditationdesignateddatahasownpropertyd datavideopleaseif2021 learndocumentgetelementbyiddivsplashclassfunction vardivsplashclassinnerhtml flowplayerissplash backgroundworkassociationjquerysrchbtndivsplashclass nullvarurl imageurlprocessrsvpbuttonclickmoduleid eventid useridrsvpbtnvalue rsvpbuttontext rsvpbtnclassname1functions varisrsvpwithformmaster varelse if dataresultisrsvpwithformmaster rsvpbtnsetattributeonclick javascriptlocationhrefmore learn moreclinicalcharsetutf8alerttemplatename setcookiearticledetailtemplatetemplatename1 alertgetcookiearticledetailtemplatebarbaraapril 28popupdivinnerhtml divhtml elsenorepeatwednesdayoverlaydivid moduleidvideoidbarbara rossleedivhtml elseclosedivflowplayerwithlightboxpopupdivid overlaydividjquerylgnbtndatad dataofficeusrequirementssuccessuserid userid portalid100 jquerylistvideopopupclose the popuprsvpedbuttontext isrsvpwithformmasterformmastertaburl returnisrsvpwithformmaster isrsvpwithformmasterall ondemandpopupdiv null popupdivstyledisplayinclusion awarddrjquerypfscrollelementscrolltoppfviewtopgraduate medical educationupdatetickert daysmore learnmeetingsjquerymnbtnsubmissionplayer moduleidsecondsacgme awardsattridplayervideoidappendtopopupdiv var divsplashclassfunctionunescapedocumentcookiesubstringcstartcend returnrsvpbtnbackgroundsize 100documentgetelementbyidoverlaydividisrsvpwithformmaster formmastertaburl ifnull divsplashclassinnerhtml catchisrsvpwithformmasterformmastertaburltype post cachewellbeingfinalrsvpprocessdata moduleidif dataresult 1areashourscrisis getgraduatepopupdivsystemrsvpbuttontext rsvpedbuttontextgraduatesexdatesetdateexdategetdateexpiredays alertexdatetogmtstringalertexpiredaysmoduleid moduleiddisplayendeducationjqueryparsejsondata varrsvpbutton if isrsvpwithformmasterifpfissafari pfscrollelement jquerybodyrsvpbuttontext rsvpbtnclassnamegetcookiecname if documentcookielength0attridplayer moduleidblockgetcookiecnameoverlaydivpopupdivinnerhtmlbedside projectcenddocumentcookieindexofcstart if cend1pfissafari false vardateif cend1function finalrsvpprocessdata moduleiddocumentgetelementbyidrsvpclick the videocontenttype applicationjsonpfscrollelement jqueryhtmljsondirectorsdataresult 12021 learn morevideoidappendtopopupdiv varagain stopaprilmoduleidchildrenappendtobody varactivitiesfunctionsshowdivflowplayerwithlightboxpopupdivid overlaydivid moduleidprocessrsvpbuttonclickmoduleidbackgroundsizecase log1 2021 learnmoduleid imageurl iffunction setcookiecnamevalueexpiredays varpfscrollelement jquerybody functiongetcookiecname ifvalue expiredaysnullpopupdivinnerhtml divhtmlshowdivflowplayerwithlightboxpopupdividexpiresexdatetogmtstringpath functiondesktopmodulespackflashpublisharticlelistcontrolsgettabarticlesaspxprocessrsvpclick var paramsrsvpbutton ifcenddocumentcookieindexofcstart ifoverviewclosedivflowplayerwithlightboxpopupdividinclusionmarksite visitpfscrollelementpopupdividindexofembed 1 varextended to wednesdaymoduleidvideoid2021 annualrsvpbuttondothrough june 1video again stopconferencesetcookiearticledetailtemplatetemplatename1response to pandemicbackgroundpositioncenternull popupdivstyledisplay blockdata jqueryparsejsondata varcarefacultyjquerypfscrollelementscrolltop jquerydiv refitemidshowif isrsvpwithformmaster rsvpbtnsetattributeonclickrsvpedbuttontext isrsvpwithformmastervideoidremovewednesday april 28back to bedsidecend1 cenddocumentcookielength returnrsvpbtn null rsvpbtnvaluedocumentcookielength0 cstartdocumentcookieindexofcnameaacomvar pfscrollelement jqueryhtmleducation communityprocess jqueryajax typersvpbtnclassname rsvpedbuttonsetcookiecnamevalueexpiredays varrsvpbtnclassname rsvpedbutton elseminutesjquerypfscrollelementscrolltopjquerypfitemclick2popupdivstyledisplay none ifclinical learning environmentcnamelength1 cenddocumentcookieindexofcstartinstitutionsisrsvpwithformmaster var rsvpbtnofficialseducationalcatcheducation learn moreif datahasownpropertyd datasessionsenvironment reviewoverlaydividequity and inclusionfunction showdivflowplayerwithlightboxpopupdivid overlaydivid100 100 jquerylistvideopopuptargeturl desktopmodulespackflashpublisharticlelistcontrolsgettabarticlesaspxprocessrsvpclick varerror in stoppingvideoidappendtopopupdivdivhtml else playerdivhtmlblock iflearn more learnemoduleidflowplayerissplash background urltargeturl desktopmodulespackflashpublisharticlelistcontrolsgettabarticlesaspxprocessrsvpclick9var exdatenew datevisitregistrationrsvpbtnsetattributeonclick javascriptlocationhref formmastertaburlportalid portalid isrsvpwithformmasterjquerylistvideopopup moduleidchildrenappendtobody varportalid isrsvpwithformmastereventid eventiduserid portalidmarchqualityif documentcookielength0applicationjson charsetutf8access to allvar divsplashclasscachejquerypfscrollelementscrolltoppfviewtop functionvideoplease clickmorecnamelength1 cenddocumentcookieindexofcstart ifpfviewtopdeadlineoverlaydivid moduleidvideoid varisrsvpwithformmaster formmastertaburlnewstopfalseextendednewsroomcstart1videoidremove attridplayer moduleidsponsoring institutionlog systemdata jqueryparsejsondatastopping videopleasenull overlaydivstyledisplayinstitution 2025var paramsalertgetcookiearticledetailtemplatesingleif isrsvpwithformmasterexdatenew date exdatesetdateexdategetdateexpiredaysresidentsif dataresultmoduleid videoidappendtopopupdivnow through junesrchbtnjavascriptlocationhref formmastertaburlclosersvpbuttontext rsvpedbuttontext isrsvpwithformmasterformmastertaburlsearchinputjqueryajax type postrefitemidoffsettop function returntobookmarkrefitemidcontributionstechnicalisrsvpwithformmaster isrsvpwithformmaster vardata params urlsuiteeducational conference nowjquerybody function bookmarkclickrefitemidimageurlsystems technical supportformmastertaburl var targeturlsetadtcookietemplatename alerttemplatename setcookiearticledetailtemplatetemplatename1cenddocumentcookielength return unescapedocumentcookiesubstringcstartcendoverlaydivstyledisplay block functiondocumentgetelementbyidrsvp moduleid eventidresourcesjquerypfscrollelementscrolltopjquerypfitem refitemidoffsettopmark functionssponsoring institution 2025acgme16hmpgrttritmactv8887 1attridplayer moduleid videoidappendtopopupdivdocumentgetelementbyiddivsplashclass moduleid ifnull rsvpbtnvalue processprojectcnamelength1documentgetelementbyidpopupdividvar pfissafarisixfunction showdivflowplayerwithlightboxpopupdividbackground url imageurlfalse varjquerypfscrollelementscrolltopjquerypfitem refitemidoffsettop functionunescapedocumentcookiesubstringcstartcendfunction processrsvpbuttonclickmoduleid eventiddivsplashclassinnerhtml catch2 rsvpbtnvaluersvpbtnclassnameif overlaydiv nullapplicationjsonmoduleidvideoid var popupdivdataresult 2 rsvpbtnvaluecontenttype applicationjson charsetutf8blogvar pfviewtop 0moduleid moduleid eventidmembersrosslee dolearningmedical education learnbackgroundsize 100 100surveysfunctions var pfviewtopflowplayerissplashvar rsvpbtnlearning environment reviewfunction processrsvpbuttonclickmoduleidpopupdividindexofembed 1dataresult 2cstartcstart cnamelength1portalid rsvpbuttontextsearchdatadcompetenciesdata systems technicalfunction ifmoduleid eventid ifdeadline extendedvalue0 varenvironment review clerif divsplashclassduringdata systemsacgmeaccreditedifpfissafarirsvpbtnclassname rsvpbuttonpopup book marktechnical supportif dataresult 2alerttemplatenametrue data paramsuserid userid3contenttypelgnbtnmnbtndiversityoverlaydivid moduleid imageurloverlaydiv nullthroughprograms and sponsoringplayerreturn unescapedocumentcookiesubstringcstartcendifpfissafari pfscrollelementrsvpbtnvalue rsvpedbuttontextcstartdocumentcookieindexofcname if cstart1environmentdivsplashclassinnerhtml flowplayerissplashsurgerytypegme accreditationrsvpbtnvaluersvpbtn documentgetelementbyidrsvpoverlaydiv documentgetelementbyidoverlaydivid ifbookmarkclickrefitemidblock elsepopupdivinnerhtml popupdivinnerhtml popupdivinnerhtmlreview clerresidents and fellowscrisis get accessnorepeat backgroundpositioncenter backgroundsizedivsplashclassjunejavascriptlocationhrefcommon program requirementscstart1 cstartcstartsetcookiearticledetailtemplatetemplatename1 alertgetcookiearticledetailtemplateurl targeturl contenttypepfissafari falseuseridimageurl varnone trybook marktoolkitjquerydiv refitemidshowsubmission deadlinecoordinatorsparamsrsvpedbuttontextjqueryajaxmoduleid videoidappendtopopupdiv varaccreditation systemeventid useridjquerybravosearchinput searchinputfunction closedivflowplayerwithlightboxpopupdividfinalrsvpprocessdata moduleid eventidsystems technicaldata dataddays hoursrefitemidhide pfviewtopmathfloordivsplashclass null divsplashclassinnerhtmldocumentcookiecname valuerefitemidhidersvpbuttontextcharsetutf8 datatype jsonvar popupdiv documentgetelementbyidpopupdividcreatedcollegesvisitsmark functions vardatatype json successprogramsmaterialscend1 cenddocumentcookielengthif cstart11 rsvpbtnvalue rsvpedbuttontextportalid portalid8function setcookiecnamevalueexpiredayssupportannualreturn false functionacgme16hmpgrttritmactv8887nullelse ifdate exdatesetdateexdategetdateexpiredays alertexdatetogmtstringalertexpiredaysrsvpbtnclassname rsvpbutton ifcstart1 cstartcstart cnamelength1postreturn function showdivflowplayerwithlightboxpopupdividnull ifnull overlaydivstyledisplay nonefalse iftargeturlmaterials acgmesingle gmeminutes secondspost cache truemoduleidchildrenappendtobody var popupdiv1 rsvpbtnvaluemedical schoolnonenull if dataresultexpiredaysnull expiresexdatetogmtstringpathpopupdiv documentgetelementbyidpopupdividbackelse playermore acgmefunction returntobookmarkrefitemid jquerydivclosedivflowplayerwithlightboxpopupdivid overlaydivid moduleidvideoidtargeturl contenttypeacgme internationalportalid isrsvpwithformmaster isrsvpwithformmasteracgme16hmpgrttrrtt8887isrsvpwithformmasterdivhtml popupdivinnerhtml popupdivinnerhtmlinstitutionif popupdividindexofembed 1popupdividindexofembedequityparams moduleidrsvpedbutton else ifvideo againacgme16hmpgrttritmnxt8887 0pfscrollelement jquerybodyprocess jqueryajaxiconxhidegmedocumentcookielength0var rsvpbtn documentgetelementbyidrsvpawards submissioneventid rsvpbuttontextdatahasownpropertyd data datadtargeturl contenttype applicationjsonprocessrsvpbuttonclickmoduleid eventidvar pfscrollelementdiversity equityportalidtruecstartcstart cnamelength1 cenddocumentcookieindexofcstartexpiredaysnull expiresexdatetogmtstringpath functionreturn functionjquerypfscrollelementscrolltoppfviewtop function processrsvpbuttonclickmoduleidmedical educationplayer moduleid videoidremoverefitemidoffsettopjquerypfscrollelementscrolltopjquerybody functiondesignated institutional officialsalertgetcookiearticledetailtemplate function setcookiecnamevalueexpiredaysparams moduleid moduleidhours minutes secondsif rsvpbtnrecognitionexdatenew datefinalrsvpprocessresult moduleidupdatetickertpfviewtop jquerypfscrollelementscrolltoppfviewtop functionacgme responsebackgroundpositioncenter backgroundsizevar popupdivif cstart1 cstartcstartsetcookiecnamevalueexpiredaysdocumentgetelementbyidoverlaydivid ifreportmoduleid eventid rsvpbuttontextreturntobookmarkrefitemid jquerydivfellowsadsrelated materialspopupdivstyledisplay blockreturn falsedivsplashclass documentgetelementbyiddivsplashclassresidency toolkitsystemsbookdivsplashclassinnerhtml catch errordayspandemic crisisrsvpbtn documentgetelementbyidrsvp moduleidexpiredaysnullvar params moduleidstaffconference nowcommonformmastertaburl ifwelcomeawards submission deadlineelsehonorcend1responserelatedlearn moredesignated institutionalcovid19learnfunction finalrsvpprocessdatadesktopmodulespackflashpublisharticlelistcontrolsgettabarticlesaspxprocessrsvpclick varrsvpbuttontext rsvpedbuttontext isrsvpwithformmasterdays hours minutesreview committeehealthoverlaydivstyledisplay28 2021medicalfunction bookmarkclickrefitemidacgme16hmpgrttritmnxt8887tjquerybodyjqueryajax typecenddocumentcookielength returnvar overlaydivdatatype jsonwork and contributionssponsoring institutionsupdatetickert days hoursmoduleid videoidremovesetcookiecnamevalueexpiredays var exdatenewparams url targeturlfunction returntobookmarkrefitemidnone iffinalrsvpprocessresult moduleid eventidschoolstop the videodivhtml popupdivinnerhtmlacgme16hmpgrttrtestagainst8887null popupdivstyledisplay none100 100acgme16hmpgrttritmarr8887lengthbookmarkclickrefitemid pfviewtopvar exdatenewmoduleid if divsplashclassrsvpedbutton elseisrsvpwithformmasterformmastertaburl return falseif popupdiv nullrsvpedbuttontext rsvpbtnclassname rsvpedbuttonsuccess functionresult finalrsvpprocessresultvar pfviewtopalertexdatetogmtstringalertexpiredaysawardscaseget accessfunction getcookiecnameiconsearchcssdisplaymoduleid videoidremove attridplayerdata datad datatry if popupdividindexofembedif documentcookielength0 cstartdocumentcookieindexofcnametrue dataawarddocumentcookielength0 cstartdocumentcookieindexofcname ifrefitemidshowformmastertaburlcenddocumentcookielengthuserid portalid portalidexpiresexdatetogmtstringpathacgme16hmpgrttrprvnxt8887acgme16hmpgrttritmnxt8887return unescapedocumentcookiesubstringcstartcend returnpopupdiv documentgetelementbyidpopupdivid varprocessdatahasownpropertydmilestoneseventid userid useridreviewnow throughsuccess functionresultbackgrounddocumentcookiecnamepopupdivinnerhtml popupdivinnerhtml divhtmljquerydiv refitemidshow jquerypfscrollelementscrolltopjquerypfitemlearn more acgmenull divsplashclassinnerhtml flowplayerissplashnull popupdivstyledisplay2021 annual educational1 vardataresult 1 rsvpbtnvaluejune 1background urlsearchinputvalfalse function finalrsvpprocessdatablock function closedivflowplayerwithlightboxpopupdividpopup bookeducational activitiescouncil of reviewfunction setadtcookietemplatename alerttemplatenameexdatenewondemandpopupdiv nullrsvpbtn null ifjquerydiv refitemidhide pfviewtopprogram directorsfunction closedivflowplayerwithlightboxpopupdivid overlaydividaccreditationinformationpfscrollelement jqueryhtml ifpfissafariresidentfellowvideorsvpbtn nullrsvpbtnvalue process jqueryajaxoverlaydiv documentgetelementbyidoverlaydividjqueryparsejsondata var rsvpbtnnull divsplashclassinnerhtmlsetadtcookietemplatenamecharsetutf8 datatype

Longtail Keyword Density for Acgme.org

KeywordsOccurences
annual educational conference16
graduate medical education13
2021 learn more12
through june 112
2021 annual educational12
1 2021 learn10
june 1 202110
now through june10
conference now through10
educational conference now10
all on-demand content10
access to all10
learn more learn8
more learn more8
back to bedside7
documentgetelementbyidrsvp moduleid eventid6
moduleid eventid if6
rsvpbtn documentgetelementbyidrsvp moduleid6
var rsvpbtn documentgetelementbyidrsvp6
divsplashclass documentgetelementbyiddivsplashclass moduleid6
rsvpedbuttontext isrsvpwithformmaster formmastertaburl6
rsvpbuttontext rsvpedbuttontext isrsvpwithformmaster6
overlaydiv null overlaydivstyledisplay6
if overlaydiv null6
popupdiv null popupdivstyledisplay6
if rsvpbtn null6
if popupdiv null6
documentgetelementbyidoverlaydivid if popupdiv6
eventid if rsvpbtn6
crisis get access6
moduleid eventid rsvpbuttontext6
eventid rsvpbuttontext rsvpedbuttontext6
documentgetelementbyidpopupdivid var overlaydiv6
var divsplashclass documentgetelementbyiddivsplashclass6
var overlaydiv documentgetelementbyidoverlaydivid6
pandemic crisis get6
response to pandemic6
popupdiv documentgetelementbyidpopupdivid var6
var popupdiv documentgetelementbyidpopupdivid6
divsplashclass null divsplashclassinnerhtml6
if divsplashclass null6
moduleid if divsplashclass6
documentgetelementbyiddivsplashclass moduleid if6
overlaydiv documentgetelementbyidoverlaydivid if6
gme accreditation system5
single gme accreditation5
equity and inclusion5
barbara ross-lee do4
medical education community4
work and contributions4
programs and sponsoring4
medical education learn4
education learn more4
return false function4
related materials acgme4
materials acgme response4
designated institutional officials4
council of review4
residents and fellows4
policies and related4
alertgetcookiearticledetailtemplate function setcookiecnamevalueexpiredays3
setcookiearticledetailtemplatetemplatename1 alertgetcookiearticledetailtemplate function3
alerttemplatename setcookiearticledetailtemplatetemplatename1 alertgetcookiearticledetailtemplate3
setadtcookietemplatename alerttemplatename setcookiearticledetailtemplatetemplatename13
function setadtcookietemplatename alerttemplatename3
rsvpbtn null rsvpbtnvalue3
null rsvpbtnvalue process3
rsvpbtnvalue process jqueryajax3
process jqueryajax type3
jqueryajax type post3
cnamelength1 cenddocumentcookieindexofcstart if3
type post cache3
isrsvpwithformmaster var rsvpbtn3
post cache true3
cache true data3
true data params3
data params url3
params url targeturl3
url targeturl contenttype3
targeturl contenttype applicationjson3
contenttype applicationjson charsetutf-83
applicationjson charsetutf-8 datatype3
charsetutf-8 datatype json3
datatype json success3
function setcookiecnamevalueexpiredays var3
userid portalid portalid3
isrsvpwithformmaster isrsvpwithformmaster var3
formmastertaburl var targeturl3
pfviewtop jquerypfscrollelementscrolltoppfviewtop function3
jquerypfscrollelementscrolltoppfviewtop function processrsvpbuttonclickmoduleid3
function processrsvpbuttonclickmoduleid eventid3
processrsvpbuttonclickmoduleid eventid userid3
eventid userid portalid3
userid portalid rsvpbuttontext3
portalid rsvpbuttontext rsvpedbuttontext3
var exdatenew date3
setcookiecnamevalueexpiredays var exdatenew3
isrsvpwithformmaster formmastertaburl var3
var targeturl desktopmodulespackflashpublisharticlelistcontrolsgettabarticlesaspxprocessrsvpclick3
portalid isrsvpwithformmaster isrsvpwithformmaster3
targeturl desktopmodulespackflashpublisharticlelistcontrolsgettabarticlesaspxprocessrsvpclick var3
desktopmodulespackflashpublisharticlelistcontrolsgettabarticlesaspxprocessrsvpclick var params3
var params moduleid3
params moduleid moduleid3
moduleid moduleid eventid3
moduleid eventid eventid3
eventid eventid userid3
eventid userid userid3
userid userid portalid3
success functionresult finalrsvpprocessresult3
portalid portalid isrsvpwithformmaster3
json success functionresult3
data systems technical3
functionresult finalrsvpprocessresult moduleid3
common program requirements3
dataresult 2 rsvpbtnvalue3
2 rsvpbtnvalue rsvpbuttontext3
rsvpbtnvalue rsvpbuttontext rsvpbtnclassname3
rsvpbuttontext rsvpbtnclassname rsvpbutton3
rsvpbtnclassname rsvpbutton if3
rsvpbutton if isrsvpwithformmaster3
if isrsvpwithformmaster rsvpbtnsetattributeonclick3
isrsvpwithformmaster rsvpbtnsetattributeonclick javascriptlocationhref3
rsvpbtnsetattributeonclick javascriptlocationhref formmastertaburl3
case log system3
transition to residency3
else if dataresult3
awards submission deadline3
extended to wednesday3
wednesday april 283
april 28 20213
learn more acgme3
sponsoring institution 20253
hours minutes seconds3
clinical learning environment3
learning environment review3
environment review cler3
days hours minutes3
if dataresult 23
rsvpedbutton else if3
finalrsvpprocessresult moduleid eventid3
if datahasownpropertyd data3
systems technical support3
jquerydiv refitemidhide pfviewtop3
rsvpbuttontext rsvpedbuttontext isrsvpwithformmasterformmastertaburl3
rsvpedbuttontext isrsvpwithformmasterformmastertaburl return3
isrsvpwithformmasterformmastertaburl return false3
false function finalrsvpprocessdata3
function finalrsvpprocessdata moduleid3
finalrsvpprocessdata moduleid eventid3
isrsvpwithformmaster formmastertaburl if3
formmastertaburl if datahasownpropertyd3
datahasownpropertyd data datad3
rsvpbtnclassname rsvpedbutton else3
data datad data3
datad data jqueryparsejsondata3
data jqueryparsejsondata var3
jqueryparsejsondata var rsvpbtn3
rsvpbtn null if3
null if dataresult3
if dataresult 13
dataresult 1 rsvpbtnvalue3
1 rsvpbtnvalue rsvpedbuttontext3
rsvpbtnvalue rsvpedbuttontext rsvpbtnclassname3
rsvpedbuttontext rsvpbtnclassname rsvpedbutton3
refitemidhide pfviewtop jquerypfscrollelementscrolltoppfviewtop3
returntobookmarkrefitemid jquerydiv refitemidhide3
cenddocumentcookieindexofcstart if cend-13
exdatesetdateexdategetdateexpiredays alertexdatetogmtstringalertexpiredays documentcookiecname3
100 100 jquerylistvideopopup3
100 jquerylistvideopopup moduleidchildrenappendtobody3
jquerylistvideopopup moduleidchildrenappendtobody var3
moduleidchildrenappendtobody var popupdiv3
getcookiecname if documentcookielength03
function getcookiecname if3
expiresexdatetogmtstringpath function getcookiecname3
expiredaysnull expiresexdatetogmtstringpath function3
value expiredaysnull expiresexdatetogmtstringpath3
documentcookiecname value expiredaysnull3
alertexdatetogmtstringalertexpiredays documentcookiecname value3
null popupdivstyledisplay block3
background-positioncenter background-size 1003
popupdivstyledisplay block if3
block if overlaydiv3
date exdatesetdateexdategetdateexpiredays alertexdatetogmtstringalertexpiredays3
exdatenew date exdatesetdateexdategetdateexpiredays3
null overlaydivstyledisplay block3
overlaydivstyledisplay block function3
block function closedivflowplayerwithlightboxpopupdivid3
function closedivflowplayerwithlightboxpopupdivid overlaydivid3
closedivflowplayerwithlightboxpopupdivid overlaydivid moduleidvideoid3
overlaydivid moduleidvideoid var3
moduleidvideoid var popupdiv3
background-size 100 1003
no-repeat background-positioncenter background-size3
popupdivstyledisplay none if3
if imageurl var3
if cend-1 cenddocumentcookielength3
cend-1 cenddocumentcookielength return3
cenddocumentcookielength return unescapedocumentcookiesubstringcstartcend3
return unescapedocumentcookiesubstringcstartcend return3
unescapedocumentcookiesubstringcstartcend return function3
return function showdivflowplayerwithlightboxpopupdivid3
function showdivflowplayerwithlightboxpopupdivid overlaydivid3
showdivflowplayerwithlightboxpopupdivid overlaydivid moduleid3
overlaydivid moduleid imageurl3
moduleid imageurl if3
imageurl if imageurl3
imageurl var divsplashclass3
imageurl no-repeat background-positioncenter3
cstartcstart cnamelength1 cenddocumentcookieindexofcstart3
cstart-1 cstartcstart cnamelength13
if cstart-1 cstartcstart3
cstartdocumentcookieindexofcname if cstart-13
documentcookielength0 cstartdocumentcookieindexofcname if3
if documentcookielength0 cstartdocumentcookieindexofcname3
null divsplashclassinnerhtml flowplayeris-splash3
divsplashclassinnerhtml flowplayeris-splash background3
flowplayeris-splash background url3
background url imageurl3
url imageurl no-repeat3
null popupdivstyledisplay none3
none if overlaydiv3
function returntobookmarkrefitemid jquerydiv3
pfscrollelement jqueryhtml ifpfissafari3
popup book mark3
book mark functions3
mark functions var3
functions var pfviewtop3
var pfviewtop 03
pfviewtop 0 var3
0 var pfissafari3
var pfissafari false3
pfissafari false var3
false var pfscrollelement3
var pfscrollelement jqueryhtml3
jqueryhtml ifpfissafari pfscrollelement3
updatetickert days hours3
ifpfissafari pfscrollelement jquerybody3
pfscrollelement jquerybody function3
jquerybody function bookmarkclickrefitemid3
function bookmarkclickrefitemid pfviewtop3
bookmarkclickrefitemid pfviewtop jquerypfscrollelementscrolltop3
pfviewtop jquerypfscrollelementscrolltop jquerydiv3
jquerypfscrollelementscrolltop jquerydiv refitemidshow3
jquerydiv refitemidshow jquerypfscrollelementscrolltopjquerypfitem3
refitemidshow jquerypfscrollelementscrolltopjquerypfitem refitemidoffsettop3
jquerypfscrollelementscrolltopjquerypfitem refitemidoffsettop function3
refitemidoffsettop function returntobookmarkrefitemid3
close the popup3
stop the video3
null overlaydivstyledisplay none3
divhtml else player3
overlaydivstyledisplay none try3
none try if3
try if popupdividindexofembed3
if popupdividindexofembed -13
popupdividindexofembed -1 var3
-1 var divhtml3
var divhtml popupdivinnerhtml3
divhtml popupdivinnerhtml popupdivinnerhtml3
popupdivinnerhtml popupdivinnerhtml popupdivinnerhtml3
popupdivinnerhtml popupdivinnerhtml divhtml3
popupdivinnerhtml divhtml else3
else player moduleid3
video again stop3
player moduleid videoidremove3
moduleid videoidremove attridplayer3
videoidremove attridplayer moduleid3
attridplayer moduleid videoidappendtopopupdiv3
moduleid videoidappendtopopupdiv var3
videoidappendtopopupdiv var divsplashclass3
null divsplashclassinnerhtml catch3
divsplashclassinnerhtml catch error3
catch error alertthere3
error in stopping3
stopping videoplease click3
click the video3
manually and close3
learn more44
medical education17
educational conference16
annual educational16
moduleid eventid15
graduate medical13
2021 learn12
june 112
through june12
2021 annual12
on-demand content12
conference now10
all on-demand10
1 202110
now through10
get access10
rsvpbuttontext rsvpedbuttontext9
more learn8
review committee8
sponsoring institutions8
jquerybravosearchinput searchinput7
function var7
null popupdivstyledisplay6
if overlaydiv6
overlaydiv null6
null overlaydivstyledisplay6
popupdivinnerhtml popupdivinnerhtml6
0 var6
popupdiv null6
if popupdiv6
divsplashclass documentgetelementbyiddivsplashclass6
documentgetelementbyidoverlaydivid if6
overlaydiv documentgetelementbyidoverlaydivid6
var overlaydiv6
documentgetelementbyidpopupdivid var6
popupdiv documentgetelementbyidpopupdivid6
var popupdiv6
null divsplashclassinnerhtml6
divsplashclass null6
if divsplashclass6
moduleid if6
documentgetelementbyiddivsplashclass moduleid6
eventid userid6
var rsvpbtn6
userid portalid6
documentgetelementbyidrsvp moduleid6
acgme awards6
if dataresult6
eventid rsvpbuttontext6
rsvpbtn null6
rsvpedbuttontext isrsvpwithformmaster6
eventid if6
if rsvpbtn6
rsvpbtn documentgetelementbyidrsvp6
var divsplashclass6
acgme response6
pandemic crisis6
crisis get6
program directors6
isrsvpwithformmaster formmastertaburl6
barbara ross-lee5
diversity equity5
april 285
single gme5
gme accreditation5
false var5
accreditation system5
case log5
acgme16hmpgrttritmactv8887 14
outstanding work4
designated institutional4
null if4
hours minutes4
ross-lee do4
days hours4
materials acgme4
health care4
medical school4
false function4
return false4
minutes seconds4
institutional officials4
education community4
function e4
related materials4
educational activities4
bedside project4
acgme international4
education learn4
json success3
datatype json3
null rsvpbtnvalue3
rsvpbtnvalue process3
process jqueryajax3
jqueryajax type3
type post3
true data3
charsetutf-8 datatype3
data params3
post cache3
contenttype applicationjson3
targeturl contenttype3
url targeturl3
cache true3
params url3
applicationjson charsetutf-83
if documentcookielength03
sponsoring institution3
desktopmodulespackflashpublisharticlelistcontrolsgettabarticlesaspxprocessrsvpclick var3
jquerypfscrollelementscrolltoppfviewtop function3
function processrsvpbuttonclickmoduleid3
processrsvpbuttonclickmoduleid eventid3
portalid rsvpbuttontext3
program requirements3
common program3
formmastertaburl var3
var targeturl3
targeturl desktopmodulespackflashpublisharticlelistcontrolsgettabarticlesaspxprocessrsvpclick3
var params3
institution 20253
params moduleid3
moduleid moduleid3
functionresult finalrsvpprocessresult3
eventid eventid3
userid userid3
portalid portalid3
portalid isrsvpwithformmaster3
isrsvpwithformmaster isrsvpwithformmaster3
isrsvpwithformmaster var3
success functionresult3
if datahasownpropertyd3
finalrsvpprocessresult moduleid3
submission deadline3
isrsvpwithformmaster rsvpbtnsetattributeonclick3
rsvpbtnsetattributeonclick javascriptlocationhref3
javascriptlocationhref formmastertaburl3
acgme16hmpgrttritmnxt8887 03
inclusion award3
deadline extended3
residency toolkit3
function if3
awards submission3
wednesday april3
rsvpbutton if3
28 20213
more acgme3
site visit3
icon-searchcssdisplay block3
clinical learning3
learning environment3
environment review3
review cler3
block else3
false if3
if isrsvpwithformmaster3
rsvpbtnclassname rsvpbutton3
updatetickert days3
data jqueryparsejsondata3
rsvpedbuttontext isrsvpwithformmasterformmastertaburl3
isrsvpwithformmasterformmastertaburl return3
function finalrsvpprocessdata3
finalrsvpprocessdata moduleid3
formmastertaburl if3
refitemidhide pfviewtop3
datahasownpropertyd data3
data datad3
datad data3
jqueryparsejsondata var3
rsvpbuttontext rsvpbtnclassname3
dataresult 13
1 rsvpbtnvalue3
rsvpbtnvalue rsvpedbuttontext3
rsvpedbuttontext rsvpbtnclassname3
rsvpbtnclassname rsvpedbutton3
rsvpedbutton else3
else if3
dataresult 23
2 rsvpbtnvalue3
rsvpbtnvalue rsvpbuttontext3
pfviewtop jquerypfscrollelementscrolltoppfviewtop3
jquerydiv refitemidhide3
documentcookielength0 cstartdocumentcookieindexofcname3
exdatenew date3
url imageurl3
imageurl no-repeat3
no-repeat background-positioncenter3
background-positioncenter background-size3
background-size 1003
100 1003
100 jquerylistvideopopup3
jquerylistvideopopup moduleidchildrenappendtobody3
moduleidchildrenappendtobody var3
exdatesetdateexdategetdateexpiredays alertexdatetogmtstringalertexpiredays3
date exdatesetdateexdategetdateexpiredays3
var exdatenew3
flowplayeris-splash background3
setcookiecnamevalueexpiredays var3
function setcookiecnamevalueexpiredays3
alertgetcookiearticledetailtemplate function3
setcookiearticledetailtemplatetemplatename1 alertgetcookiearticledetailtemplate3
alerttemplatename setcookiearticledetailtemplatetemplatename13
popupdivstyledisplay block3
block if3
setadtcookietemplatename alerttemplatename3
function setadtcookietemplatename3
technical support3
overlaydivstyledisplay block3
background url3
divsplashclassinnerhtml flowplayeris-splash3
function closedivflowplayerwithlightboxpopupdivid3
return function3
cstartdocumentcookieindexofcname if3
if cstart-13
cstart-1 cstartcstart3
cstartcstart cnamelength13
cnamelength1 cenddocumentcookieindexofcstart3
cenddocumentcookieindexofcstart if3
if cend-13
cend-1 cenddocumentcookielength3
cenddocumentcookielength return3
return unescapedocumentcookiesubstringcstartcend3
unescapedocumentcookiesubstringcstartcend return3
function showdivflowplayerwithlightboxpopupdivid3
alertexdatetogmtstringalertexpiredays documentcookiecname3
showdivflowplayerwithlightboxpopupdivid overlaydivid3
overlaydivid moduleid3
moduleid imageurl3
imageurl if3
if imageurl3
imageurl var3
getcookiecname if3
function getcookiecname3
expiresexdatetogmtstringpath function3
expiredaysnull expiresexdatetogmtstringpath3
value expiredaysnull3
documentcookiecname value3
block function3
closedivflowplayerwithlightboxpopupdivid overlaydivid3
returntobookmarkrefitemid jquerydiv3
jqueryhtml ifpfissafari3
popup book3
book mark3
mark functions3
functions var3
var pfviewtop3
pfviewtop 03
log system3
var pfissafari3
pfissafari false3
var pfscrollelement3
pfscrollelement jqueryhtml3
ifpfissafari pfscrollelement3
again stop3
pfscrollelement jquerybody3
jquerybody function3
function bookmarkclickrefitemid3
bookmarkclickrefitemid pfviewtop3
pfviewtop jquerypfscrollelementscrolltop3
jquerypfscrollelementscrolltop jquerydiv3
jquerydiv refitemidshow3
refitemidshow jquerypfscrollelementscrolltopjquerypfitem3
jquerypfscrollelementscrolltopjquerypfitem refitemidoffsettop3
refitemidoffsettop function3
function returntobookmarkrefitemid3
video manually3
video again3
overlaydivid moduleidvideoid3
systems technical3
moduleidvideoid var3
popupdivstyledisplay none3
none if3
overlaydivstyledisplay none3
none try3
try if3
if popupdividindexofembed3
popupdividindexofembed -13
-1 var3
var divhtml3
divhtml popupdivinnerhtml3
popupdivinnerhtml divhtml3
videoplease click3
divhtml else3
else player3
player moduleid3
moduleid videoidremove3
videoidremove attridplayer3
attridplayer moduleid3
moduleid videoidappendtopopupdiv3
videoidappendtopopupdiv var3
data systems3
catch error3
error alertthere3
stopping videoplease3
divsplashclassinnerhtml catch3
var75
if72
function52
more47
learn45
acgme42
moduleid33
medical31
029
null28
123
educational22
education21
eventid21
conference20
program20
accreditation20
data19
else16
medicine16
all16
annual16
isrsvpwithformmaster15
graduate15
us14
surgery14
review14
false13
on-demand12
through12
content12
get12
june12
rsvpedbuttontext12
institutional12
access12
rsvpbuttontext12
popupdiv12
awards12
rsvpbtn12
overlaydiv12
212
block12
divsplashclass12
sponsoring11
return11
gme10
institutions10
now10
committee10
programs10
acgme16hmpgrttritmnxt888710
pandemic10
formmastertaburl9
imageurl9
portalid9
popupdivinnerhtml9
system9
pfviewtop9
userid9
rsvpbtnvalue9
directors8
crisis8
residents8
other8
well-being8
council7
back7
bedside7
systems7
osteopathic7
milestones7
award7
acgme16hmpgrttritmactv88877
searchinput7
jquerybravosearchinput7
requirements7
response6
residency6
jquerydiv6
video6
error6
divhtml6
none6
overlaydivstyledisplay6
popupdivstyledisplay6
international6
seconds6
documentgetelementbyidoverlaydivid6
documentgetelementbyidpopupdivid6
site6
36
icon-x6
url6
divsplashclassinnerhtml6
documentgetelementbyiddivsplashclass6
icon-xhide6
american6
pfscrollelement6
care6
meetings6
rsvpbtnclassname6
coordinators6
overlaydivid6
recognition6
documentgetelementbyidrsvp6
resources6
params6
targeturl6
minutes6
overview6
diversity6
dataresult6
inclusion6
health6
hours6
days6
equity5
barbara5
visit5
process5
clinical5
deadline5
ross-lee5
extended5
cler5
covid-195
april5
do5
book5
toolkit5
45
transition5
single5
lgnbtn5
true5
e5
common5
jquerytpnvmn5
case5
log5
date5
project4
displaystart4
office4
mathfloor4
54
school4
policies4
fellows4
search4
searchinputval4
association4
residentfellow4
displayend4
graduates4
designated4
officials4
leadership4
activities4
members4
staff4
competencies4
institution4
registration4
call4
sessions4
acgme16hmpgrttrprvnxt8887acgme16hmpgrttritmnxt88874
acgme16hmpgrttritmarr8887length4
colleges4
created4
mnbtn4
materials4
acgme-accredited4
jquerybody4
jqueryhtml4
their4
resource4
areas4
six4
quality4
jgme4
visits4
periodic4
jquerymnbtn4
faculty4
srchbtn4
march4
outstanding4
during4
welcome4
help4
related4
community4
work4
contributions4
field4
information4
javascriptlocationhref3
datad3
63
rsvpbutton3
rsvpbtnsetattributeonclick3
jqueryparsejsondata3
datahasownpropertyd3
finalrsvpprocessdata3
rsvpedbutton3
getcookiecname3
73
jquerylgnbtn3
environment3
learning3
specialty3
suite3
aacom3
wednesday3
submission3
honor3
icon-searchcssdisplay3
jquerysrchbtn3
acgme16hmpgrttrtestagainst88873
jquerythissiblingsshadow3
new3
t3
finalrsvpprocessresult3
updatetickert3
dr3
self-study3
83
acgme16hmpgrttrrtt88873
isrsvpwithformmasterformmastertaburl3
post3
functionresult3
blog3
setcookiecnamevalueexpiredays3
alertgetcookiearticledetailtemplate3
jquerylistvideopopup3
moduleidchildrenappendtobody3
setcookiearticledetailtemplatetemplatename13
alerttemplatename3
setadtcookietemplatename3
newsroom3
no-repeat3
closedivflowplayerwithlightboxpopupdivid3
moduleidvideoid3
ads3
try3
popupdividindexofembed3
93
support3
background-positioncenter3
exdatenew3
player3
unescapedocumentcookiesubstringcstartcend3
cstartdocumentcookieindexofcname3
cstart-13
cstartcstart3
cnamelength13
cenddocumentcookieindexofcstart3
cend-13
cenddocumentcookielength3
showdivflowplayerwithlightboxpopupdivid3
background3
expiresexdatetogmtstringpath3
expiredaysnull3
value3
documentcookiecname3
alertexdatetogmtstringalertexpiredays3
exdatesetdateexdategetdateexpiredays3
flowplayeris-splash3
technical3
videoidremove3
success3
jqueryajax3
returntobookmarkrefitemid3
refitemidhide3
jquerypfscrollelementscrolltoppfviewtop3
processrsvpbuttonclickmoduleid3
desktopmodulespackflashpublisharticlelistcontrolsgettabarticlesaspxprocessrsvpclick3
report3
initiatives3
type3
jquerypfscrollelementscrolltopjquerypfitem3
documentcookielength03
cache3
contenttype3
applicationjson3
charsetutf-83
datatype3
json3
refitemidoffsettop3
refitemidshow3
attridplayer3
again3
videoidappendtopopupdiv3
catch3
surveys3
alertthere3
stopping3
videoplease3
click3
stop3
jquerypfscrollelementscrolltop3
manually3
close3
popup3
mark3
functions3
pfissafari3
ifpfissafari3
bookmarkclickrefitemid3
background-size3

Who hosts Acgme.org?

Acgme.org Hosting Provider Information

Hosted IP Address:63.84.4.100
Hosted Hostname:www.acgme.org
Service Provider:MCI Communications Services, Inc. d/b/a Verizon Business
Hosted Country:United StatesUS
Location Latitude:36.1671
Location Longitude:-86.7861
Webserver Software:Not Applicable

Is "MCI Communications Services, Inc. d/b/a Verizon Business" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
%

HTTP Header Analysis for Acgme.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache
Pragma: no-cache
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
X-Frame-Options: SAMEORIGIN
X-UA-Compatible: IE=edge
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Sun, 28 Mar 2021 19:34:13 GMT

Acgme.org Domain Nameserver Information

HostIP AddressCountry
ns1.acgme.org 63.84.4.9
ns2.acgme.org 12.197.60.9


Need to find out who hosts Acgme.org?


Domain Registration (WhoIs) information for Acgme.org

 WHOIS LIMIT EXCEEDED - SEE WWW.PIR.ORG/WHOIS FOR DETAILS 

Websites with Similar Names

Acgme-i.org
ACGME International > Home
Acgme.org
ACGME Home
Acgmedia.site
Retail Print Media: The Solution to Your Print Media Needs
Acgmedical.com
ACG Medical Supply Store – Get quality medical supplies
Acgmedya.com
License Failure

Recently Updated Websites

Adobefill.com (1 second ago.)Tread-up.net (2 seconds ago.)P0wned.wtf (3 seconds ago.)Speakerhustle.live (4 seconds ago.)Bonanzitizing.com (4 seconds ago.)Windmilltaverns.com (4 seconds ago.)Myopensim.com (4 seconds ago.)Tictube.online (5 seconds ago.)Ariamethod.com (5 seconds ago.)Adspecialties.promo (6 seconds ago.)Cjsfoundation.org (6 seconds ago.)Boffy.one (7 seconds ago.)Preetiaryan.club (7 seconds ago.)Cwsystemsllc.com (7 seconds ago.)Obrienpeoria.com (7 seconds ago.)Inkomtrans.ru (7 seconds ago.)Novastar.shop (8 seconds ago.)Vizeofis.com (8 seconds ago.)Sudsyshotsauce.com (9 seconds ago.)Harborrock-d.com (10 seconds ago.)Antiqueshunter.co.uk (10 seconds ago.)8x8xwww.com (10 seconds ago.)Abopcr-covid19.com (10 seconds ago.)Cure-c.org (11 seconds ago.)Albi-light.net (12 seconds ago.)Personaltrainer.tv (12 seconds ago.)Xaloy.com (12 seconds ago.)Synapstek.com (13 seconds ago.)Telvecit.com (13 seconds ago.)Wpasra.com (14 seconds ago.)

Recently Searched Keywords

ou lautre bout (1 second ago.)679 358 (1 second ago.)desentavan straforu (1 second ago.)братья райт магазин (1 second ago.)amateurfunk (2 seconds ago.)10 самых интересных скульптур и памятников со всего мира (2 seconds ago.)угольную золу в огород (3 seconds ago.)optivision (3 seconds ago.)host country (6 seconds ago.)none width 100 (8 seconds ago.)switch nintendo (9 seconds ago.)categories insurance (10 seconds ago.)wanted to say (12 seconds ago.)доступно вgoogle play (13 seconds ago.)rgb149 (13 seconds ago.)infinity pool (14 seconds ago.)monde et profitez (15 seconds ago.)slidesperview ionic (17 seconds ago.)двойное проникновение (17 seconds ago.)hanako (19 seconds ago.)bakanmz (20 seconds ago.)abhipraya meaning in english (21 seconds ago.)10-11.屋顶上开干惨被偷拍 (21 seconds ago.)if were (23 seconds ago.)hygiène bio (25 seconds ago.)thưởng thức đặc sản thịt lợn sapa – đậm đà bản sắc dân tộc (27 seconds ago.)uniques tout autour (27 seconds ago.)oman (28 seconds ago.)pranayama (28 seconds ago.)eririka 10-16 eririka (29 seconds ago.)