Ackermann.ch  |  Mode Online Shop - Kleidung - Schuhe - Möbel kaufen Ackermann Versand
Low trust score  | 
Ackermann Online-Shop - Versandhaus für Damenmode, Herrenmode, Kinder- Kleidung, Schuhe und Möbel. ? 24/7 ? auf Rechnung und ? in Raten bestellen

Ackermann.ch Website Information

Ackermann.ch has a Low Trust Score, a Statvoo Rank of H, an Alexa Rank of 143,021, a Majestic Rank of 940,565, a Domain Authority of 46% and is not listed in DMOZ.

Ackermann.ch is hosted by SOPRADO GmbH in Germany.
Ackermann.ch has an IP Address of 91.236.122.1 and a hostname of x5bec7a01.host.myracloud.com and runs myracloud web server.

The domain ackermann.ch was registered 201 decades 8 years 11 months ago by SWITCH Domain Name Registration, it was last modified 201 decades 8 years 11 months ago and currently is set to expire 201 decades 8 years 11 months ago.


Whois information for ackermann.ch

Full Whois Lookup for Ackermann.ch Whois Lookup

The number of requests per client per time interval is
restricted. You have exceeded this limit.
Please wait a moment and try again.

Who hosts Ackermann.ch?

Ackermann.ch Web Server Information

Hosted IP Address:91.236.122.1
Hosted Hostname:x5bec7a01.host.myracloud.com
Service Provider:SOPRADO GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:myracloud

HTTP Header Analysis for Ackermann.ch

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: myracloud
Date: Sat, 18 Jul 2015 01:41:14 GMT
Content-Type: text/html;charset=utf-8
Content-Length: 30321
Connection: keep-alive
Vary: host, accept-encoding
Cache-Control: no-cache,no-store,must-revalidate
Pragma: no-cache
P3P: policyref="/content/w3c/p3p.xml", CP="NOI NID PSAa OUR BUS COM NAV STA"
Accept-Ranges: bytes
Content-Encoding: gzip


Need to find out who hosts Ackermann.ch?

Ackermann.ch Free SEO Report

Website Inpage Analysis for Ackermann.ch

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Ackermann.ch

showavgrating showstrikeprice formatmoneyoldpriceformatmoneyeinbestellenmoumlbelnbspzursmartphoneswirimdaskategoriensaving showsavingsie eswenn sievorhandenshowsaving shortnameshortnameshortnameshortnamenameshortname energyefficiencyclassheadlinebezahlenshortnameshortnameshortnameshortnamenameshortname energyefficiencyclass energieeffizienzackermann online servicezur verfgungenergyefficiencyclass energieeffizienzmarken modenbsp bestsellernbspjungenmwsthintnbsp marken modenbspshowstrikeprice formatmoneyoldpriceformatmoneyfrshowsaving shortnameshortnameshortnameshortnamenameshortnameshowavgrating showstrikepriceformatmoneyoldpriceformatmoney frompriceab frompriceformatmoneypriceformatmoneyversuchen siebabynbsp markenkindergibt esversandsellingunit formatmoneysellingunitpriceformatmoney showpriceperunitfrompriceformatmoneypriceformatmoneymbelpasswortfrompriceab frompriceformatmoneypriceformatmoney showstrikepriceonlineenergyefficiencyclass energyefficiencyclass showavgratingjetztsichaufackermann online shopenergyefficiencyclass energieeffizienz energyefficiencyclassbestsellernbsp data0ampenergyefficiencyclass showavgratingsie sichsuchenshowstrikeprice formatmoneyoldpriceformatmoney frompriceabihremenergyefficiencyclass energyefficiencyclassdata0 showsaving savingfrompriceab frompriceformatmoneypriceformatmoneyemailadressesaved showstrikepriceihrersaving showsaving shortnameshortnameshortnameshortnamenameshortnameshortnameshortnameshortnameshortnamenameshortnamesellingunit formatmoneysellingunitpriceformatmoneyshowstrikeprice showstrikepricechfganznewsletterist nichtknnenshowstrikeprice showstrikeprice frompriceabfrompriceformatmoneypriceformatmoney showstrikepriceformatmoneysellingunitpriceformatmoney showpriceperunit data0zubehoumlrshowstrikeprice showpriceperunit sellingunitnochshirtsshowpriceperunit data0showpriceperunitmchtenfrompriceabrucksaumlckeformatmoneysellingunitpriceformatmoneybestsellernbspwohnenshoppingdamensindeineurlackermannenergieeffizienz energyefficiencyclass energyefficiencyclassazsortimentfehlertypefrompriceformatmoneypriceformatmoney saved showstrikepriceaccessoiresdataonline servicestehensavingsiedependencelineitemsformatmoneyoldpriceformatmoneyvalueshowpriceperunit sellingunit formatmoneysellingunitpriceformatmoneynacheinenmodenbsp bestsellernbsp data0showpriceperunit data0 topsellergartenmoumlbelimage imageihremarkenbersichtshowsaving savinganmeldenfrompriceformatmoneypriceformatmoney showstrikeprice showpriceperunitformatmoneysellingunitpriceformatmoney showpriceperunitbitteenergieeffizienznichtbestsellernbsp data0 showsavingarticlesshowavgrating showavgrating showstrikepricedemberatungkindermodeshowstrikeprice frompriceabshortnameshortnameshortnameshortnamenameshortname energyefficiencyclassshowstrikeprice frompriceab frompriceformatmoneypriceformatmoneyservicederenergieeffizienz energyefficiencyclassmarken modenbspshowavgrating showavgratingwarenkorbzuwirdsellingunitartikelmodenbspvon azhosenversuchen sie esdirektweiterewennunsdata0 topsellerdenshowstrikeprice showpriceperunitdieverfgungdurchamp zubehoumlrder ackermannackermann online versandimageenergyefficiencyclass showavgrating showavgratinglieberpromotionproductodermitdata0modefr dieesdatenschutzcountshowsaving saving showsavingmeineonline shopdannonline versandsaved showstrikeprice showstrikepricewerdenhaben siebasepriceknnen sietopsellerihnenbeim ackermannfrompriceab frompriceformatmoneypriceformatmoney savedkaufender ackermann onlineausvonfrompriceformatmoneypriceformatmoney savednurvombeimquantityackermann versandmodenbsp bestsellernbspshowsavingversuchendamenmodeumzumshowpriceperunit sellingunitdata0 showsavingsavedbademodehabenauchproductnamegibtschuhedennherrensportbekleidungshopbeiackermann onlineshowstrikepriceenergyefficiencyclassjeansshowavgratingformatmoneyoldpriceformatmoney frompriceabistwie

Longtail Keyword Density for Ackermann.ch

KeywordsOccurences
der ackermann online6
ackermann online shop4
showstrikeprice frompriceab frompriceformatmoneypriceformatmoney4
frompriceab frompriceformatmoneypriceformatmoney showstrikeprice3
frompriceformatmoneypriceformatmoney showstrikeprice showpriceperunit3
showstrikeprice showstrikeprice frompriceab3
showstrikeprice showpriceperunit sellingunit3
frompriceformatmoneypriceformatmoney saved showstrikeprice3
saved showstrikeprice showstrikeprice3
sellingunit formatmoneysellingunitpriceformatmoney showpriceperunit3
ackermann online versand3
versuchen sie es3
ackermann online service3
showpriceperunit data0 topseller3
frompriceab frompriceformatmoneypriceformatmoney saved3
formatmoneysellingunitpriceformatmoney showpriceperunit data03
showpriceperunit sellingunit formatmoneysellingunitpriceformatmoney3
showstrikeprice formatmoneyoldpriceformatmoney frompriceab3
data0 showsaving -saving3
showsaving -saving showsaving3
-saving showsaving shortnameshortnameshortnameshortnamenameshortname3
bestsellernbsp data0 showsaving3
modenbsp bestsellernbsp data03
nbsp marken modenbsp3
marken modenbsp bestsellernbsp3
showsaving shortnameshortnameshortnameshortnamenameshortname energyefficiencyclass3
shortnameshortnameshortnameshortnamenameshortname energyefficiencyclass energieeffizienz3
showavgrating showavgrating showstrikeprice3
showavgrating showstrikeprice formatmoneyoldpriceformatmoney3
energyefficiencyclass showavgrating showavgrating3
energyefficiencyclass energyefficiencyclass showavgrating3
energyefficiencyclass energieeffizienz energyefficiencyclass3
energieeffizienz energyefficiencyclass energyefficiencyclass3
formatmoneyoldpriceformatmoney frompriceab frompriceformatmoneypriceformatmoney3
ackermann online13
frompriceab frompriceformatmoneypriceformatmoney7
der ackermann7
ackermann versand6
knnen sie6
online shop6
wenn sie5
showstrikeprice frompriceab5
amp zubehoumlr4
beim ackermann4
haben sie4
sie es4
von a-z4
zur verfgung4
sie sich4
formatmoneysellingunitpriceformatmoney showpriceperunit3
sellingunit formatmoneysellingunitpriceformatmoney3
showpriceperunit sellingunit3
versuchen sie3
showpriceperunit data03
gibt es3
showstrikeprice showpriceperunit3
online versand3
fr die3
online service3
data0 topseller3
saved showstrikeprice3
data0 showsaving3
showsaving -saving3
-saving showsaving3
showsaving shortnameshortnameshortnameshortnamenameshortname3
bestsellernbsp data03
modenbsp bestsellernbsp3
image image3
ist nicht3
nbsp marken3
marken modenbsp3
shortnameshortnameshortnameshortnamenameshortname energyefficiencyclass3
energyefficiencyclass energieeffizienz3
showstrikeprice formatmoneyoldpriceformatmoney3
formatmoneyoldpriceformatmoney frompriceab3
frompriceformatmoneypriceformatmoney saved3
showstrikeprice showstrikeprice3
showavgrating showstrikeprice3
showavgrating showavgrating3
energieeffizienz energyefficiencyclass3
energyefficiencyclass energyefficiencyclass3
energyefficiencyclass showavgrating3
frompriceformatmoneypriceformatmoney showstrikeprice3
amp74
sie44
ackermann33
nbsp32
die25
der23
online20
fr20
showstrikeprice14
ein13
oder13
zum12
ihnen11
zu11
von9
energyefficiencyclass9
schuhe9
versand9
damen9
knnen9
sind9
data8
auf8
ist8
den8
frompriceab8
es8
newsletter7
meine7
haben7
frompriceformatmoneypriceformatmoney7
accessoires7
herren7
das7
service7
zubehoumlr6
data06
mbel6
shop6
wenn6
anmelden6
artikel6
showsaving6
ihrer6
sich6
showpriceperunit6
image6
showavgrating6
zur6
auch6
ihre6
mit6
bei6
kindermode5
uns5
nach5
nicht5
noch5
mode5
eine5
headline5
beim5
bademode5
mchten5
weitere4
wir4
dem4
aus4
nur4
kaufen4
a-z4
warenkorb4
e-mail-adresse4
passwort4
wird4
type4
im4
productname4
promotionproduct4
quantity4
dependencelineitems4
articles4
mwsthint4
werden4
bestsellernbsp4
verfgung4
jeans4
kategorien4
bitte4
shopping3
fehler3
bestellen3
versuchen3
bezahlen3
vorhanden3
einen3
sortiment3
ganz3
suchen3
wie3
denn3
stehen3
ihrem3
damenmode3
formatmoneyoldpriceformatmoney3
vom3
bersicht3
jetzt3
hosen3
shirts3
modenbsp3
marken3
sportbekleidung3
beratung3
direkt3
count3
value3
url3
baseprice3
chf3
durch3
dann3
-saving3
shortnameshortnameshortnameshortnamenameshortname3
smartphones3
gartenmoumlbel3
moumlbel3
rucksaumlcke3
gibt3
lieber3
datenschutz3
wohnen3
jungen3
sellingunit3
saved3
energieeffizienz3
formatmoneysellingunitpriceformatmoney3
topseller3
baby3
kinder3
um3

What are the nameservers for ackermann.ch?

Ackermann.ch Domain Nameserver Information

HostIP AddressCountry
dns1.inode.at 195.34.133.133Austria Austria
dns2.inode.at 213.47.222.133Austria Austria

Ackermann.ch Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Ackermann.ch is a scam?