American Chemical Society

Safety: High trust score
Year Founded: 1991
Global Traffic Rank: 785
Estimated Worth: $20,581,560
Category: Science > Chemistry

ACS is one of the world’s largest scientific society and the premier home of chemistry professionals. Find career opportunities, educational resources and more.



Domain summary

Last updated
2021-12-09
Domain label
acs
Domain extension
org
Domain registered:
1991-05-22
Domain updated:
2021-12-09
Global Traffic Rank
785
Statvoo Rating
A
Trust Score
High trust score
Estimated worth
$20,581,560
Estimated daily income
$19,057
Estimated monthly income
$579,650

Frequently Asked Questions (FAQ)

Q: When was Acs.org registered?
A: Acs.org was registered 30 years, 11 months, 3 weeks, 4 days, 22 hours, 10 minutes, 6 seconds ago on Wednesday, May 22, 1991.
Q: When was the WHOIS for Acs.org last updated?
A: The WHOIS entry was last updated 5 months, 1 week, 22 hours, 10 minutes, 6 seconds ago on Thursday, December 9, 2021.
Q: What are Acs.org's nameservers?
A: DNS for Acs.org is provided by the following nameservers:
  • dns1.g01.ns1global.org
  • dns3.g01.ns1global.org
  • dns2.g01.ns1global.org
  • dns4.g01.ns1global.org
Q: Who is the registrar for the Acs.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Acs.org?
A: Acs.org ranks 785 globally on Alexa. Acs.org has a High trust score, and a Statvoo Rank of A.
Q: How many people visit Acs.org each day?
A: Acs.org receives approximately 2,382,166 visitors and 19,057,328 page impressions per day.
Q: What IP address does Acs.org resolve to?
A: Acs.org resolves to the IPv4 address .
Q: In what country are Acs.org servers located in?
A: Acs.org has servers located in the .
Q: What webserver software does Acs.org use?
A: Acs.org is powered by webserver.
Q: Who hosts Acs.org?
A: Acs.org is hosted by Unknown in .
Q: How much is Acs.org worth?
A: Acs.org has an estimated worth of $20,581,560. An average daily income of approximately $19,057, which is roughly $579,650 per month.

Acs.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Acs.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Acs.org

H1 Headings

1 :
  1. Welcome to Amerian Chemical Society

H2 Headings

14 :
  1. Introducing your New ACS Membership for 2022
  2. Connect with the World's Largest Scientific Community
  3. Discover more with ACS scientific resources
  4. Advance your Career in the Global Economy
  5. Promote Excellence in Education
  6. ACS takes your privacy seriously
  7. EXPLORE ACS
  8. MOLECULE OF THE WEEK
  9. Improve the world through the transforming power of chemistry
  10. Improve the world through the transforming power of chemistry
  11. Improve the world through the transforming power of chemistry
  12. Improve the world through the transforming power of chemistry
  13. Improve the world through the transforming power of chemistry
  14. Your Success is Our Success

H3 Headings

0 :

H4 Headings

6 :
  1. Meetings & Events
  2. Careers
  3. Students & Educators
  4. Communities
  5. Discover Chemistry
  6. Funding & Awards

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

22 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

116:

Links - Internal (nofollow)

0:

Links - Outbound

6:

Links - Outbound (nofollow)

0:

Keyword Cloud for Acs.org

students educatorsbenefittruecommunitiesviewnumbers advancinglearn morescienceworld throughppeople joinpaddingtopcqiframemedia screenfunction cqiframe thisattrsrcglobalowlcarouselsingleacsnumbersfunction cqiframeprivacystrengthstrength in numbersacsnbsp nbspnbspmakehome owlcarouselpeopleacsprofileauthorrunmodeearthchemistry weearth and itsbenefit of earthnbspnbspmakeourusenterpriserenewgtworldcareeradvancingacsnbsppractitionersgreen chemistrychemistry enterpriseacsprofilehasemailpowerfunding awardshomemotwacsprofileisloggedinlocal sectionsthrough the transformingresourcesjoin acsnbsp nbspnbspmakeacsprofilehasauthtokenenterprise and itsawardstechnical divisionsadvancing the broaderbackgroundcolorlearn more gtcqenewslettersubscribedifference improvejoin acsnbspnetworkslidecaption pmore gtlearnmoretrue iftechnicaleventspersonalallstudentsfalsefunctionyouexploreresultsappenddivisionscqiframe thisattrsrctransformingthisattrsrcdiscoverdiscover chemistryits peoplewe are strengthpeople join acsnbspmeetingssectionsslidecaptionowlcarouselbroader chemistry enterprisetransforming power0informationdatavideosexplorenewdifferenceits practitionersimprove the worldpower of chemistrychemicalitswelocalvarjoingetfindmembershipscreenresearchifsuccessnullgreenimgbroader chemistryeducatorsmediachemistrycareersthroughpaddingbottommaxwidth50pxyour careerimproveview allmeetings eventsyourits people joinnbspnbspmake a differencefundingbroaderscientifichome

Longtail Keyword Density for Acs.org

KeywordsOccurences
learn more gt5
improve the world5
through the transforming5
power of chemistry5
we are strength5
strength in numbers5
advancing the broader5
broader chemistry enterprise5
enterprise and its5
benefit of earth5
earth and its5
nbspnbspmake a difference5
function cqiframe thisattrsrc4
its people join3
people join acsnbsp3
join acsnbsp nbspnbspmake3
home owl-carousel9
view all6
media screen6
numbers advancing5
world through5
broader chemistry5
green chemistry5
chemistry we5
transforming power5
its people5
more gt5
learn more5
its practitioners5
chemistry enterprise5
difference improve4
true if4
function cqiframe4
cqiframe thisattrsrc4
your career4
funding awards3
people join3
join acsnbsp3
acsnbsp nbspnbspmake3
discover chemistry3
local sections3
slide-caption p3
technical divisions3
students educators3
meetings events3
chemistry27
acs23
your15
if13
its12
owl-carousel11
home10
var9
function9
more8
awards8
we8
career8
view8
world7
resources6
meetings6
join6
advancing6
screen6
img6
media6
learn6
science6
true6
chemical6
explore6
all6
transforming5
practitioners5
power5
strength5
numbers5
through5
improve5
broader5
enterprise5
gt5
nbspnbspmake5
benefit5
earth5
people5
05
difference5
events5
slide-caption5
false5
cqenewslettersubscribe5
green5
home-motw4
us4
cqiframe4
explore-resultsappend4
thisattrsrc4
local4
you4
divisions4
educators4
discover4
careers4
membership4
renew4
students4
our4
data4
padding-top4
50px4
padding-bottom4
background-color4
find4
personal3
null3
max-width3
acsprofileauthorrunmode3
acsprofilehasemail3
acsprofilehasauthtoken3
acsprofileisloggedin3
communities3
success3
network3
owl-carouselsingle3
global3
technical3
p3
sections3
research3
videos3
funding3
acsnbsp3
new3
scientific3
information3
privacy3
get3

Who hosts Acs.org?

Acs.org Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Not Applicable

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.9161%
GOOGLE
14.0532%
AS-26496-GO-DADDY-COM-LLC
3.4879%
NAMECHEAP-NET
3.1470%
AMAZON-AES
2.2136%
GoDaddy.com, LLC
2.0287%
UNIFIEDLAYER-AS-1
1.9645%
Fara Negar Pardaz Khuzestan
1.6143%
CONFLUENCE-NETWORK-INC
1.4660%
1&1 Internet AG
1.3358%

HTTP Header Analysis for Acs.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 09 Dec 2021 12:16:22 GMT
Server: Apache/2.4.6 (Red Hat Enterprise Linux) OpenSSL/1.0.2k-fips Communique/4.2.3
Vary: Host,Accept-Encoding
Last-Modified: Wed, 08 Dec 2021 22:52:15 GMT
Content-Encoding: gzip
Access-Control-Allow-Origin: *
X-Forwarded-For: 18.130.185.235
Incap-Client-IP: 18.130.185.235
X-Country: GB
Accept-Ranges: none
Referrer-Policy: no-referrer-when-downgrade
Cache-Control: public, max-age=600
Content-Type: text/html; charset=utf-8
Content-Security-Policy: frame-ancestors 'self' acs.virtualeventsengine.com virtualexhibits360.com psav.digital
X-CDN: Imperva
Transfer-Encoding: chunked
X-Iinfo: 9-221773681-221773684 SNNN RT(1639052180812 339) q(0 0 0 -1) r(1 1) U5

Acs.org Domain Nameserver Information

HostIP AddressCountry
dns1.g01.ns1global.org 198.51.44.9
dns3.g01.ns1global.org 198.51.44.73
dns2.g01.ns1global.org 198.51.45.9
dns4.g01.ns1global.org 198.51.45.73


Need to find out who hosts Acs.org?


Domain Registration (WhoIs) information for Acs.org

 Domain Name: ACS.ORG
Registry Domain ID: D862922-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2021-11-02T17:08:37Z
Creation Date: 1991-05-22T04:00:00Z
Registry Expiry Date: 2023-05-23T04:00:00Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8777228662
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: American Chemical Society
Registrant State/Province: DC
Registrant Country: US
Name Server: DNS1.G01.NS1GLOBAL.ORG
Name Server: DNS3.G01.NS1GLOBAL.ORG
Name Server: DNS2.G01.NS1GLOBAL.ORG
Name Server: DNS4.G01.NS1GLOBAL.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2021-12-09T12:15:22Z

Websites with Similar Names

Recently Updated Websites

Sattaking-no.com (3 minutes 14 seconds ago.)Sattaking-up.com (5 minutes 7 seconds ago.)Fre-skate-lesson.site (19 minutes 10 seconds ago.)Make.com (29 minutes 5 seconds ago.)Factoriacultural.es (40 minutes 17 seconds ago.)Numanzia.com (45 minutes 55 seconds ago.)Nftcode-it.com (51 minutes 6 seconds ago.)Gurugamer.com (57 minutes 44 seconds ago.)Satta-kingn.in (1 hour 3 minutes ago.)Z1fm.online (1 hour 19 minutes ago.)Fesehatk.com (1 hour 38 minutes ago.)Ntinews.com (1 hour 47 minutes ago.)Blumble.com (2 hours 55 minutes ago.)Klamboe.com (4 hours 12 minutes ago.)Boot-upstrongintenselytheproduct.vip (4 hours 19 minutes ago.)Cacheeye.com (4 hours 58 minutes ago.)Sattaking-result.com (5 hours 54 minutes ago.)Sattanom.in (5 hours 56 minutes ago.)Ghostbookwriting.services (5 hours 57 minutes ago.)Satta-king.online (5 hours 58 minutes ago.)Sattaking-number.com (5 hours 59 minutes ago.)Satta-king-king.com (6 hours 2 minutes ago.)Notfcompreviews.com (6 hours 4 minutes ago.)Separatecolonist.com (6 hours 4 minutes ago.)Sattakingy.in (6 hours 4 minutes ago.)Ml.miuqf.xyz (6 hours 5 minutes ago.)Sattakingking.com (6 hours 6 minutes ago.)Sattakingindia.com (6 hours 9 minutes ago.)Www-jointrestoregummies.com (6 hours 16 minutes ago.)Pgjoker4d.com (6 hours 45 minutes ago.)

Recently Searched Keywords

amazing home ideas (1 second ago.)boqueiro (2 seconds ago.)2022 hello (4 seconds ago.)takealot returns contact number (4 seconds ago.)  plu (5 seconds ago.)αλλα (7 seconds ago.)аћић: потписани споразуми о помоћи србима у фбих (7 seconds ago.)image-locatorattrsrc (8 seconds ago.)hirdoboz.hu (8 seconds ago.)link know (8 seconds ago.)android5.2k (9 seconds ago.)projekty domów parterowych (11 seconds ago.)este mdulo (12 seconds ago.)bcsix fact sheet (12 seconds ago.)ve haberler (13 seconds ago.)importantpadding-left 19 (13 seconds ago.)indian council (14 seconds ago.)fototapeten (14 seconds ago.)instagram for business (15 seconds ago.)right-20pxbackground-position100 0 (15 seconds ago.)skuteczne sposoby na zrzucenie zbędnych kilogramów i poprawę odporności organizmu (15 seconds ago.)flights to florida (16 seconds ago.)dmca (16 seconds ago.)did brandon (16 seconds ago.)delete this style (16 seconds ago.)mike in brazil (17 seconds ago.)cash advance debt consolidation insurance books 4 you.biz (17 seconds ago.)pictures (17 seconds ago.)not find any (17 seconds ago.)johnny was (17 seconds ago.)