Actcorp.in  |  ACT Fibernet | 100 Mbps | Internet Connection | Broadband High Speed
High trust score  | 
ACT Fibernet is one of the leading internet broadband service providers in across Karnataka, Telangana, Andhra Pradesh and Tamil Nadu. We have a wide range of high speed internet plans starting at Rs.615




Actcorp.in Website Information

Website Ranks & Scores for Actcorp.in

Statvoo Rank Statvoo Rank:B
Alexa Rank Alexa Rank:3,268
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:10%
DMOZ DMOZ Listing:No

Whois information for actcorp.in

Full Whois Lookup for Actcorp.in Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Actcorp.in. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only, and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.

Domain ID:D8459934-AFIN
Domain Name:ACTCORP.IN
Created On:03-Jun-2014 11:55:18 UTC
Last Updated On:27-Jul-2015 18:54:08 UTC
Expiration Date:03-Jun-2019 11:55:18 UTC
Sponsoring Registrar:Endurance Domains Technology LLP (R173-AFIN)
Status:CLIENT TRANSFER PROHIBITED
Reason:
Registrant ID:WIQ_28106157
Registrant Name:Domain Officer
Registrant Organization:Atria Convergence Technologies Pvt Ltd
Registrant Street1:#1/2, 2nd Floor, Indian Express Building,
Registrant Street2:Line 2: (Optional)
Registrant Street3:
Registrant City:Bangalore
Registrant State/Province:Karnataka
Registrant Postal Code:560001
Registrant Country:IN
Registrant Phone:+91.9538886565
Registrant Phone Ext.:
Registrant FAX:
Registrant FAX Ext.:
Registrant Login to show email
ID:WIQ_28106157
Admin Name:Domain Officer
Admin Organization:Atria Convergence Technologies Pvt Ltd
Admin Street1:#1/2, 2nd Floor, Indian Express Building,
Admin Street2:Line 2: (Optional)
Admin Street3:
Admin City:Bangalore
Admin State/Province:Karnataka
Admin Postal Code:560001
Admin Country:IN
Admin Phone:+91.9538886565
Admin Phone Ext.:
Admin FAX:
Admin FAX Ext.:
Admin Login to show email
ID:WIQ_28106157
Tech Name:Domain Officer
Tech Organization:Atria Convergence Technologies Pvt Ltd
Tech Street1:#1/2, 2nd Floor, Indian Express Building,
Tech Street2:Line 2: (Optional)
Tech Street3:
Tech City:Bangalore
Tech State/Province:Karnataka
Tech Postal Code:560001
Tech Country:IN
Tech Phone:+91.9538886565
Tech Phone Ext.:
Tech FAX:
Tech FAX Ext.:
Tech Login to show email
Server:DNS1.BIGROCK.IN
Name Server:DNS3.BIGROCK.IN
Name Server:NS1.ACTCORP.CO.IN
Name Server:NS2.ACTCORP.CO.IN
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned

Who hosts Actcorp.in?

Actcorp.in is hosted by Beam Telecom Pvt Ltd in Telangana, Hyderabad, India, 500018.
Actcorp.in has an IP Address of 202.53.8.120 and a hostname of ras.beamtele.net.



Actcorp.in Web Server Information

Hosted IP Address:202.53.8.120
Hosted Hostname:ras.beamtele.net
Service Provider:Beam Telecom Pvt Ltd
Hosted Country:IndiaIN
Location Latitude:17.3753
Location Longitude:78.4744
Webserver Software:Not Applicable

HTTP Header Analysis for Actcorp.in

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 08 Jun 2015 17:44:38 GMT
Server: Apache/2.2.3 (CentOS)
X-Powered-By: PHP/5.2.10
P3P: CP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM"
Expires:
Cache-Control: private
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8


Need to find out who hosts Actcorp.in?

Actcorp.in Free SEO Report

Website Inpage Analysis for Actcorp.in

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:pub-4088454058165991
Google Analytics:Not Applicable

Keyword Cloud for Actcorp.in

urlselectfibernetpayact fibernetareacitylookvarinstallappwrapperhideeasyeasy to payyourclickidincredibletvactwe

Longtail Keyword Density for Actcorp.in

KeywordsOccurences
easy to pay3
act fibernet8
your13
act10
fibernet8
var5
pay4
url4
look3
easy3
installappwrapperhide3
tv3
we3
area3
city3
incredible3
id3
select3
click3

What are the nameservers for actcorp.in?


Actcorp.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Actcorp.in is a scam?