Actfa.net Favicon Actfa.net

Actfa.net Website Thumbnail
Checking...
Welcome to the Australian Controlled Traffic Farming Association
Low trust score
Add a review Change category Claim this site
The Australian Controlled Traffic Farming Association is a not for profit, run by volunteers from across the grains and horticulture industries. ACTFA’s activities have included CTF conferences, projects and some advocacy and policy work such as submissions to Parliamentary enquiries. > LEARN MORE ABOUT CTF


Domain summary

Domain label
actfa
Domain extension
net
Domain registered:
2006-02-23
Domain updated:
2019-11-26
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is actfa.net ranked relative to other sites:

Percentage of visits to actfa.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Actfa.net registered?
A: Actfa.net was registered 14 years, 8 months, 5 days, 20 hours, 45 minutes, 7 seconds ago on Thursday, February 23, 2006.
Q: When was the WHOIS for Actfa.net last updated?
A: The WHOIS entry was last updated 11 months, 2 days, 20 hours, 45 minutes, 7 seconds ago on Tuesday, November 26, 2019.
Q: What are Actfa.net's nameservers?
A: DNS for Actfa.net is provided by the following nameservers:
  • ns3.secureparkme.com
  • ns4.secureparkme.com
Q: Who is the registrar for the Actfa.net domain?
A: The domain has been registered at Dreamscape Networks International Pte Ltd.
Q: What is the traffic rank for Actfa.net?
A: Actfa.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Actfa.net each day?
A: Actfa.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Actfa.net resolve to?
A: Actfa.net resolves to the IPv4 address 27.54.90.33.
Q: In what country are Actfa.net servers located in?
A: Actfa.net has servers located in the Australia.
Q: What webserver software does Actfa.net use?
A: Actfa.net is powered by Nginx webserver.
Q: Who hosts Actfa.net?
A: Actfa.net is hosted by Aust Domains International Pty Ltd. in Australia.
Q: How much is Actfa.net worth?
A: Actfa.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Actfa.net?

Actfa.net Hosting Provider Information

Hosted IP Address:27.54.90.33
Hosted Hostname:rsl-cp6-27-54-90-33-virtual.au.syrahost.com
Service Provider:Aust Domains International Pty Ltd.
Hosted Country:AustraliaAU
Location Latitude:-33.494
Location Longitude:143.2104
Webserver Software:nginx

Is "Aust Domains International Pty Ltd." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Actfa.net

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx
Date: Tue, 20 Oct 2020 09:54:13 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 0
X-Powered-By: PHP/7.3.18
X-Pingback: http://www.actfa.net/xmlrpc.php
X-Redirect-By: WordPress
Location: https://www.actfa.net/
Cache-Control: max-age=0
Expires: Tue, 20 Oct 2020 09:54:12 GMT

Actfa.net Domain Nameserver Information

HostIP AddressCountry
ns3.secureparkme.com 27.124.125.1
ns4.secureparkme.com 27.124.125.2


Need to find out who hosts Actfa.net?


WhoIs information for Actfa.net

 Domain Name: ACTFA.NET
Registry Domain ID: 355012110_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.syrahost.com
Registrar URL: http://www.crazydomains.com
Updated Date: 2019-11-26T11:04:21Z
Creation Date: 2006-02-23T00:00:00Z
Registrar Registration Expiration Date: 2022-02-23T00:00:00Z
Registrar: Dreamscape Networks International Pte Ltd
Registrar IANA ID: 1291
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +61.894220890
Reseller: SANDY TAYLOR MARKETING & DESIGN
Domain Status: ok https://icann.org/epp#ok
Registry Registrant ID: R-022409667-SN
Registrant Name: CHRIS BLUETT
Registrant Organization:
Registrant Street: 823 HITCHCOCK ROAD
Registrant City: BUNINYONG
Registrant State/Province: VIC
Registrant Postal Code: 3357
Registrant Country: AU
Registrant Phone: +61.0409336113
Registrant Phone Ext:
Registrant Email: Login to show email
Admin ID: C-008268533-SN
Admin Name: CHRIS BLUETT
Admin Organization:
Admin Street: 823 HITCHCOCK ROAD
Admin City: BUNINYONG
Admin State/Province: VIC
Admin Postal Code: 3357
Admin Country: AU
Admin Phone: +61.0409336113
Admin Phone Ext:
Admin Email: Login to show email
Tech ID: C-008268533-SN
Tech Name: CHRIS BLUETT
Tech Organization:
Tech Street: 823 HITCHCOCK ROAD
Tech City: BUNINYONG
Tech State/Province: VIC
Tech Postal Code: 3357
Tech Country: AU
Tech Phone: +61.0409336113
Tech Phone Ext:
Tech Email: Login to show email
Server: NS3.SECUREPARKME.COM
Name Server: NS4.SECUREPARKME.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-11-26T11:04:21Z

Actfa.net Free SEO Report

Website Inpage Analysis for Actfa.net

H1 Headings

1 :
  1. Welcome to THE AUSTRALIAN CONTROLLED TRAFFIC FARMING ASSOCIATION

H2 Headings

2 :
  1. WHY CONTROLLED TRAFFIC FARMING?
  2. NEW: On the right track – controlled traffic in the low rainfall zone of south-eastern Australia

H3 Headings

0 :

H4 Headings

1 :
  1. AGM: By video conference Thurs 20th August 12pm AEST, 10am WA.

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

24 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-49099815-23

Links - Internal

26:
  1. Login
    https://www.actfa.net/wp-admin/
  2. No text
    https://www.actfa.net/
  3. Home
    https://www.actfa.net/
  4. About
    https://www.actfa.net/about/
  5. About Controlled Traffic Farming
    https://www.actfa.net/controlled-traffic-farming/
  6. About ACTFA
    https://www.actfa.net/about/
  7. The ACTFA Board
    https://www.actfa.net/actfa-board/
  8. CTF Resources
    https://www.actfa.net/ctf-resources/
  9. CTF Articles
    https://www.actfa.net/ctf-resources/ctf-articles/
  10. CTF Case Studies
    https://www.actfa.net/ctf-case-studies/
  11. Controlled Traffic Farming Australia Magazine
    https://www.actfa.net/ctf-resources/controlled-traffic-farming-australia-magazine/
  12. Talking CTF Podcast
    https://www.actfa.net/ctf-resources/talking-ctf-podcast/
  13. ACTFA Conferences
    https://www.actfa.net/actfa-conferences/
  14. ACTFA Conference
    https://www.actfa.net/actfa-conferences/
  15. Past Conferences
    https://www.actfa.net/past-conferences/
  16. ACTFA Projects
    https://www.actfa.net/projects/
  17. Sponsorship
    https://www.actfa.net/sponsorship/
  18. Contact
    https://www.actfa.net/contact/
  19. Membership
    https://www.actfa.net/membership/
  20. No text
    https://www.actfa.net/membership/
  21. No text
    https://www.actfa.net/controlled-traffic-farming-australia-magazine/
  22. No text
    https://www.actfa.net/ctf-resources/talking-ctf-podcast/
  23. No text
    https://www.actfa.net/actfa-conferences/
  24. FIND OUT MORE
    https://www.actfa.net/controlled-traffic-farming/
  25. No text
    https://www.actfa.net/ctf-resources/
  26. No text
    https://www.actfa.net/ctf-resources/ctf-articles/

Links - Internal (nofollow)

0:

Links - Outbound

9:
  1. No text
    https://www.youtube.com/channel/UCJI8Y3DJ-6-qPQuNpsLINVw
  2. Facebook
    https://www.facebook.com/AusCTF/
  3. Twitter
    https://twitter.com/ctfarmingaus
  4. No text
    https://drive.google.com/file/d/1uPgUq3c69WDc48XYn2KwWaLUgh4xjVUg/view?usp=sharing
  5. DOWNLOAD
    https://drive.google.com/file/d/1uPgUq3c69WDc48XYn2KwWaLUgh4xjVUg/view?usp=sharing
  6. No text
    https://www.australia.gov.au
  7. No text
    https://grdc.com.au
  8. No text
    https://www.youtube.com/channel/UCJI8Y3DJ-6-qPQuNpsLINVw?view_as=subscriber
  9. Sandy Taylor Digital Marketing
    http://www.sandytaylor.com.au

Links - Outbound (nofollow)

0:

Keyword Cloud for Actfa.net

svgfpplayroundedfill flowplayerh2fpcontrolshoversvgfpplayroundedfill flowplayerfpoutlinedfpwaiting svgfpplaysharpfillflowplayerischromecastwebkittransform 02s transitionfptimelineemhoverfppause svgfploadingroundedfillcontentleft0 right 05emlinearfpwaiting svgfploadingroundedfill displaygrainbottom 3emfpui fpplayfpvisiblefacebookfacebook twitterwebkitfilterstrongfpshare2beforezoneflowplayernoflexnone flowplayerscaley135fpwaiting svgfploadingroundedoutlineflowplayerfpoutlined7svgfppauseroundedfill flowplayerfpoutlinedscale08flowplayernosvg fpui fpplayfpvisibleflowplayerisseeking fpwaitingflowplayerisrtlflowplayerfpplayfulbackgroundimage nonescaley06whitespace nowrapfpwaiting svgfpplayroundedfillsvgfppauseroundedoutlineflowplayer fpbarslider backgroundcolorsvgfpplayroundedoutline flowplayerfpedgytransition opacityheight 100whitespacewebkittransitionfpemailbefore025videofpenginefontsize 90top 0svgfploadingsharpoutline flowplayerfpedgyfpminimalblockflex9emabsolute height255 255fpui fpcontrolsdisplayfpunloadbefore contentflowplayerfpedgy fppauseflowplayerfpslimfpbarslider heightfpplaybtnbeforeablocksgallerygridiscroppedfpwaiting displayheight 2emfpplayfpvisiblefpairplaybefore contentscale16emfppausetwittersvgfpplaysharpfill flowplayerfpedgyfpoutlinedfpmenuflowplayer fpuiawpblockgalleryiscroppedfontfamily2s heightfpplay svgfpplaysharpfilltop 9999emalphaopacity0 opacityflowplayerfpedgy fpplaytransition opacity 2s0 flowplayerfpfull0 0 025display inlineblocktransition transform 02sheight 2s transitionflowplayerfpminimal fpplaycontrolled trafficsvgfploadingroundedfill displayalphaopacity100 opacityfptimeline heightsvgfpplaysharpfill flowplayerfpedgyfpminimalfpwaiting svgfpnextbeforesvgflowplayerfpdefaultplaylistfpwaiting svgfploadingsharpfill0 left 0filter alphaopacity100 importantborderboxaustraliancolor fff flowplayermsflexsvgfppausesharpoutline flowplayerfpedgyfpoutlinedsvgfpplayroundedoutlinefppause svgfpplayroundedoutlinefontweightfpuifpcontextmenusvgfploadingroundedoutlineflowplayerfpoutlined fpplayfppause svgfpplayroundedfillsvgfpplaysharpfillflowplayerfpedgyfpoutlinedsvgfppauseroundedfill flowplayertextalign centersvgfpplaysharpoutline flowplayerfpedgyfpoutlinedflowplayerfpfullfpbarslider emhoverfpnextbtnbefore contentfpcontrols displayfigcaption2s transitionimgwpblockgalleryiscroppedfpplay svgfploadingroundedoutlineposition absolutenone1 flowplayerborderradius 0fpbarslider eminheritflowplayer fpcaptionsdisplay blockscale12fpfullscreenbefore contentbackgroundcolor rgba0ffffpcontrolsfpplaylist02s transition transformalphaopacity0 opacity 0fpcheckedbefore content2s height 2simportant opacity 1width 100scaley075display none flowplayeraustraliaopacity 1 importantrgba255 25508em1px0 05transitionheight 2simgblocksgallerygridfontweight boldfppause svgfppausesharpfill4flowplayerfpedgyfpminimal fpwaitingfpbuffer0 right9999em100 borderradiuslow rainfall zone6fpplay svgfploadingsharpfill3flowplayernosvg fpuifpwaiting svgfppausesharpfillemfppause svgfploadingroundedoutlineopacity 2sopacity 1 flowplayerflowplayerfpfat100 flowplayerflowplayer fpcontrolssvgfppausesharpoutline flowplayerfpedgyfpminimalflowplayerfpedgyfpminimalfpairplaybefore0 bottomfpwaiting svgfploadingroundedfillflowplayerfpplayful fpbarsliderfpsharebefore contentflowplayer fpbarsliderfpenginefpplay svgfpplayroundedoutlinetbody0 flowplayerfontsizefpplaybtnrotate180degfilterboldpositionwebkitstickysvgfpplayroundedfill flowplayerfpminimal032s transition opacitysvgfppauseroundedoutline flowplayerfpoutlinedright 0flowplayer fpchromecastenginebackgroundcolorfpplay svgfppauseroundedoutlinefpfacebookbefore contentoverflow hiddenwebkittransform 02simportant opacityabsolute topfpunloadbeforewebkittransition webkittransform04em1 importantopacityheight 2s webkittransformflowplayerispausedsvgfppauseroundedoutline flowplayerfpminimalflowplayerisfullscreensvgfpplayroundedoutline flowplayerfpoutlinedfppause svgfploadingsharpfill0 filterctf2s webkittransform 2s0 0marginflowplayer fpcontextmenufpui fpheadersvgfpplaysharpoutline flowplayerfpedgyfpminimalcenterflowplayernosvgflowplayerisseekingfppause svgfppauseroundedoutlinezindexrgba0 0 0fpprevbtnbefore content05solidwebkitflexinfiniteflowplayerfpedgy fpwaiting16pxfilter alphaopacity0 opacityrgba255 255 255bottomdisplay none importantborderradius 2em0 bottom 00 025auto flowplayerfpprevbtnbeforefpsharebeforeflowplayerfpminimal fppauseposition absolute topfpcheckedbeforeflowplayerpositionsvgfppausesharpfill flowplayerfpedgyec6c4csvgfploadingroundedfill flowplayerfpminimalopacity 1fptwitterbeforeall10pxsvgfppauseroundedfillfpembedbefore contentfpprevbefore contentwpblocknavigationcontainer02sfpembedbeforefpemailbefore contentpsvgfploadingsharpfill flowplayerfpedgyfpminimalsvgfploadingsharpfill12em0 filter alphaopacity0ebookfptwitterbefore contentfilter alphaopacity100 opacityflowplayerisflashdisabled fpuifpchromecastenginedisplay nonealphaopacity100 important opacityrelativesvgfppausesharpfill flowplayerfpedgyfpminimalfpwaitingnone importantopacity 0height autofpcolor0 top 0fpcontrols backgroundcolorrainfall zonepaddingflowplayerisflashdisabledfpunload2sposition relative28embackgroundcolor 3330 importantsvgfppauseroundedoutline flowplayerfpedgyfpheader fpunloadmstransformfpplay displaywpsociallinkfpplayflowplayerisloadingsvgfppausesharpfill flowplayerfpedgyfpoutlinedgrdcflowplayer fpwaitingcontrolled traffic farmingalphaopacity100transform0 topfpwaiting p2s webkittransformfpui fpplaytopfpprevbeforeheightsvg flowplayersvgfppauseroundedfill flowplayerfpedgyfill1emimgwpblockgallery blocksgalleryitemblocksgalleryitemsvgfppausesharpoutlinetransform 02sposition absolute heighttextalignsvgfpplaysharpfill flowplayerfpedgytextalign lefttransparent524emrgba0webkittransform 04sflowplayerislivenormalbackgroundcolor rgba0 0flowplayerfpminimal fpwaitingfpbarslider backgroundcolorbackgroundimageeditorstyleswrapperfigurewpblockgallerycolor fffrightscale095flowplayerfpedgyfpminimal fppause100 importantflowplayer fpbarimportantactfafpwaiting svgfpplayroundedoutlinerainfallflowplayerfpdefaultplaylist fpplaylistmargin 0low rainfalltrafficfpplay svgfppausesharpfillflowplayerfpedgyfpoutlined fppausefpwaiting svgfppauseroundedfillflowplayerfpoutlined fppause02s transitionfpduration0 025 transparentflowplayerfpminimalfpwaiting svgfppauseroundedoutlineall 2sflowplayer fpplaybottom 0fpplay svgfppauseroundedfillrgba255flowplayer fppauseborderradiusfpfullscreenbeforefpiconinlineblock1backgroundcolor rgba255fpplay svgfploadingroundedfillalphaopacity100 importantbottom 0 topscale15alphaopacity100 opacity 12flowplayerisloading fpuiwebkittransition opacityfpvolumeoffbefore contenttable0traffic farmingflowplayerfpedgy04s transitionfptimestampwebkittransformfpplayer0 leftscale11fpchromecastbeforecolorrgba0 0scale12 12svgfpplayroundedoutline flowplayerfpminimalfontfamily flowplayerflowplayer fpheaderopacity 03sflowplayerfpoutlined fpwaitingfppause svgfpplaysharpfillflowplayer fpmenu3emfpnextbtnbeforenone important flowplayerhiddencursorfpshare2before contentfpplaybtnbefore contentvideofpengine webkitfilterblocksgalleryimagetransition transformfpsharemenuflowplayerfpedgyfpoutlined fpwaitingsvgfploadingroundedfillfpvolumebtnbefore contentimgwpblockgallery blocksgalleryimageleft 0 rightimgblocksgallerygrid blocksgalleryitemcontrolledfpbarsliderfpheadersvgfploadingroundedoutline flowplayerfpedgy025 transparentalphaopacity0growersfppause svgfppauseroundedfillyousvgfpplaysharpoutlinelowfpbarflowplayer fpsharemenu4emfpremainingtransition webkittransformfarmingwidth 100 flowplayerverticalalignfpvolumebtnbefore04ssvgfppauseroundedfill flowplayerfpminimalfpchromecastbefore contentoverflowfilter alphaopacity0cccheight 9emflowplayerisloading fpwaitingfpfacebookbeforeimgwpblockgalleryright 0 bottomfpcaptionswidthsvgfploadingsharpoutlineflowplayerismouseoverfpnextbefore content1sfff flowplayer03sflowplayerfpfat fpbarsliderflowplayerfpedgyfpoutlined fpplay2emnowrapleft 0fpplay svgfpplayroundedfillflowplayerispostermaxwidth0 0 05webkittransform 2sflowplayerfpedgyfpminimal fpplayfpvolumeoffbeforeautobackgroundcolor rgba255 255bottom autosvgfpplayroundedfillfilter alphaopacity100svgfploadingroundedoutline flowplayerfpminimalsvgfpplayroundedfill flowplayerfpedgyabsolutesvgfppausesharpfillimportant flowplayer

Longtail Keyword Density for Actfa.net

KeywordsOccurences
rgba0 0 012
filter alphaopacity100 opacity10
display none flowplayer10
alphaopacity100 opacity 110
filter alphaopacity0 opacity9
alphaopacity0 opacity 09
controlled traffic farming7
display none important6
background-color rgba0 06
0 0 0256
0 right 05
rgba255 255 2555
0 bottom 05
0 025 transparent4
left 0 right4
transition transform 02s4
02s transition transform4
-webkit-transform 02s transition4
2s height 2s4
color fff flowplayer4
opacity 1 flowplayer4
position absolute height3
background-color rgba255 2553
flowplayer fp-bar-slider background-color3
0 0 053
height 2s transition3
2s transition opacity3
2s -webkit-transform 2s3
height 2s -webkit-transform3
flowplayerno-svg fp-ui fp-playfp-visible3
0 top 03
bottom 0 top3
none important flowplayer3
width 100 flowplayer3
right 0 bottom3
low rainfall zone3
fp-waiting svgfp-loading-rounded-fill display3
position absolute top3
0 left 03
0 filter alphaopacity03
opacity 1 important3
important opacity 13
alphaopacity100 important opacity3
filter alphaopacity100 important3
transition opacity 2s3
display none30
position absolute17
display block17
0 017
opacity 113
filter alphaopacity10013
rgba0 012
filter alphaopacity011
opacity 011
top 011
none flowplayer11
0 important10
none important10
alphaopacity100 opacity10
width 10010
controlled traffic10
flowplayerfp-edgy fp-waiting9
flowplayerfp-edgy fp-play9
flowplayerfp-edgy fp-pause9
alphaopacity0 opacity9
traffic farming8
height 1008
height 2s8
left 08
fp-volumebtnbefore content8
flowplayer fp-bar-slider8
fp-fullscreenbefore content8
color fff8
fp-playbtnbefore content8
transition opacity7
02s transition7
flowplayer fp-header7
flowplayer fp-waiting7
display inline-block7
bottom 07
important flowplayer7
2s transition7
flowplayer fp-menu7
0 0256
flowplayerfp-edgyfp-minimal fp-waiting6
flowplayerfp-minimal fp-play6
flowplayerfp-edgyfp-outlined fp-waiting6
flowplayerfp-edgyfp-outlined fp-pause6
flowplayerfp-edgyfp-minimal fp-pause6
flowplayerfp-outlined fp-play6
transition transform6
flowplayerfp-outlined fp-waiting6
flowplayerfp-outlined fp-pause6
-webkit-transform 02s6
flowplayerfp-minimal fp-waiting6
flowplayerfp-edgyfp-outlined fp-play6
flowplayerfp-minimal fp-pause6
flowplayerfp-edgyfp-minimal fp-play6
background-color rgba06
flowplayer fp-ui6
255 2555
0 bottom5
right 05
rgba255 2555
0 right5
flowplayer fp-play5
-webkit-transition opacity5
flowplayer fp-pause5
1 flowplayer5
margin 05
flowplayer fp-controls5
flowplayerno-svg fp-ui5
important opacity5
fp-play svgfp-play-rounded-fill4
transform 02s4
fp-bar-slider height4
fp-pause svgfp-play-rounded-fill4
svg flowplayer4
fp-pause svgfp-pause-rounded-fill4
fp-play svgfp-loading-rounded-fill4
025 transparent4
flowplayer fp-bar4
auto flowplayer4
fp-waiting svgfp-loading-rounded-fill4
opacity 03s4
height 9em4
text-align left4
fp-pause svgfp-loading-rounded-fill4
fp-waiting svgfp-play-rounded-fill4
fp-play svgfp-pause-rounded-fill4
fp-waiting svgfp-pause-rounded-fill4
flowplayerfp-fat fp-bar-slider4
fp-facebookbefore content4
fp-ui fp-controls4
flowplayeris-loading fp-ui4
fp-nextbtnbefore content4
fp-prevbtnbefore content4
fp-unloadbefore content4
fp-volume-offbefore content4
fp-twitterbefore content4
flowplayerfp-playful fp-bar-slider4
fp-share2before content4
fp-sharebefore content4
fp-emailbefore content4
fp-chromecastbefore content4
fp-embedbefore content4
fp-checkedbefore content4
fp-airplaybefore content4
fp-ui fp-play4
all 2s4
fp-waiting display4
border-radius 04
flowplayerfp-default-playlist fp-playlist4
fp-nextbefore content4
fp-prevbefore content4
fp-timeline height4
position relative4
text-align center4
fff flowplayer4
opacity 2s4
2s height4
fp-controls display4
2s -webkit-transform4
1 important4
background-color 3334
0 053
font-weight bold3
border-radius 2em3
0 flowplayer3
0 top3
0 flowplayerfp-full3
height 2em3
flowplayer fp-context-menu3
svgfp-loading-rounded-outline flowplayerfp-minimal3
svgfp-pause-rounded-outline flowplayerfp-outlined3
svgfp-pause-rounded-outline flowplayerfp-minimal3
svgfp-play-rounded-outline flowplayerfp-outlined3
svgfp-play-rounded-outline flowplayerfp-minimal3
svgfp-loading-rounded-fill flowplayerfp-minimal3
svgfp-pause-rounded-fill flowplayerfp-outlined3
svgfp-pause-rounded-fill flowplayerfp-minimal3
svgfp-play-rounded-fill flowplayerfp-outlined3
svgfp-play-rounded-fill flowplayerfp-minimal3
flowplayer fp-share-menu3
-webkit-transform 2s3
svgfp-play-rounded-fill flowplayer3
fp-bar-slider emhover3
04s transition3
-webkit-transform 04s3
fp-bar-slider em3
white-space nowrap3
font-size 903
100 border-radius3
absolute height3
background-color rgba2553
fp-bar-slider background-color3
svgfp-pause-rounded-fill flowplayer3
overflow hidden3
facebook twitter3
100 flowplayer3
fp-waiting p3
fp-play svgfp-play-rounded-outline3
svgfp-pause-rounded-fill flowplayerfp-edgy3
svgfp-play-rounded-fill flowplayerfp-edgy3
scale12 123
transition -webkit-transform3
-webkit-transition -webkit-transform3
absolute top3
bottom auto3
0 left3
flowplayer fp-chromecast-engine3
0 filter3
height auto3
flowplayeris-flash-disabled fp-ui3
fp-header fp-unload3
fp-waiting svg3
fp-play svgfp-pause-rounded-outline3
bottom 3em3
low rainfall3
rainfall zone3
imgblocks-gallery-grid blocks-gallery-item3
imgwp-block-gallery blocks-gallery-image3
imgwp-block-gallery blocks-gallery-item3
font-family flowplayer3
top -9999em3
alphaopacity100 important3
fp-ui fp-header3
fp-play display3
100 important3
background-image none3
flowplayeris-loading fp-waiting3
flowplayeris-seeking fp-waiting3
svgfp-play-rounded-outline flowplayerfp-edgy3
svgfp-pause-rounded-outline flowplayerfp-edgy3
flowplayer fp-captions3
fp-waiting svgfp-play-sharp-fill3
fp-ui fp-playfp-visible3
fp-controls background-color3
svgfp-loading-sharp-outline flowplayerfp-edgyfp-minimal3
svgfp-pause-sharp-outline flowplayerfp-edgyfp-outlined3
svgfp-pause-sharp-outline flowplayerfp-edgyfp-minimal3
svgfp-play-sharp-outline flowplayerfp-edgyfp-outlined3
svgfp-play-sharp-outline flowplayerfp-edgyfp-minimal3
svgfp-loading-sharp-fill flowplayerfp-edgyfp-minimal3
svgfp-pause-sharp-fill flowplayerfp-edgyfp-outlined3
svgfp-pause-sharp-fill flowplayerfp-edgyfp-minimal3
svgfp-play-sharp-fill flowplayerfp-edgyfp-outlined3
svgfp-play-sharp-fill flowplayerfp-edgyfp-minimal3
fp-waiting svgfp-loading-sharp-fill3
fp-waiting svgfp-pause-sharp-fill3
fp-pause svgfp-loading-sharp-fill3
fp-play svgfp-loading-rounded-outline3
fp-waiting svgfp-loading-rounded-outline3
svgfp-loading-rounded-outline flowplayerfp-edgy3
fp-pause svgfp-play-rounded-outline3
fp-pause svgfp-pause-rounded-outline3
fp-pause svgfp-loading-rounded-outline3
fp-waiting svgfp-play-rounded-outline3
fp-waiting svgfp-pause-rounded-outline3
svgfp-loading-rounded-fill display3
fp-pause svgfp-pause-sharp-fill3
fp-play svgfp-play-sharp-fill3
svgfp-play-sharp-fill flowplayerfp-edgy3
fp-play svgfp-pause-sharp-fill3
svgfp-pause-sharp-fill flowplayerfp-edgy3
fp-play svgfp-loading-sharp-fill3
fp-pause svgfp-play-sharp-fill3
videofp-engine -webkit-filter3
flowplayer106
0103
content87
display67
none54
flowplayerfp-edgy52
fp-waiting49
editor-styles-wrapper47
fp-play44
important42
height41
flowplayerfp-minimal39
opacity38
fp-pause38
fp-ui35
flowplayerfp-edgyfp-minimal34
flowplayerfp-outlined34
flowplayerfp-edgyfp-outlined34
width30
filter29
background-color26
-webkit-transform25
125
bottom25
2s23
transition23
fp-bar-slider23
blocks-gallery-item22
left22
top21
position21
transform21
blocks-gallery-image20
220
center19
block17
absolute17
auto16
color15
fp-header15
-webkit-transition15
right15
fp-controls15
border-radius13
font-size13
fp-bar13
-ms-transform13
alphaopacity10013
fp-playbtnbefore12
fp-fullscreenbefore12
fp-volumebtnbefore12
svgfp-loading-rounded-fill12
flowplayerfp-default-playlist12
02s12
svgfp-pause-rounded-fill12
svgfp-play-rounded-fill12
rgba012
fp-timeline11
traffic11
background-image11
alphaopacity011
controlled10
text-align10
margin10
farming10
1s10
fff10
flowplayerfp-playful10
9em10
310
flowplayeris-loading9
fp-menu9
svg9
svgfp-play-rounded-outline9
svgfp-loading-sharp-fill9
svgfp-pause-sharp-fill9
svgfp-play-sharp-fill9
all9
svgfp-loading-rounded-outline9
svgfp-pause-rounded-outline9
flowplayerfp-full9
transparent8
fp-playlist8
3em8
ctf8
actfa8
2em7
fp-nextbefore7
fp-prevbefore7
12em7
inline-block7
flowplayerfp-fat7
fp-captions7
1em7
fp-checkedbefore6
fp-chromecastbefore6
0256
fp-emailbefore6
fp-engine6
strong6
fp-share2before6
fp-twitterbefore6
fp-facebookbefore6
fp-airplaybefore6
fp-volume-offbefore6
imgwp-block-gallery6
scale086
scale16
fp-embedbefore6
tbody6
fp-unloadbefore6
fp-prevbtnbefore6
fp-nextbtnbefore6
svgfp-play-sharp-outline6
svgfp-pause-sharp-outline6
svgfp-loading-sharp-outline6
fp-sharebefore6
-9999em5
flowplayerfp-slim5
5em5
overflow5
16px5
position-webkit-sticky5
fp-timestamp5
rgba2555
fp-icon5
flowplayerno-svg5
p5
padding5
flowplayeris-poster5
6em5
australia5
04s5
cursor5
flowplayeris-flash-disabled5
fp-buffer5
wp-social-link4
h24
flowplayeris-chromecast4
you4
054
font-family4
fp-playbtn4
relative4
flex4
-webkit-flex4
infinite4
solid4
03s4
44
figurewp-block-gallery4
fp-playfp-visible4
figcaption4
flowplayeris-seeking4
ablocks-gallery-gridis-cropped4
imgwp-block-galleryis-cropped4
awp-block-galleryis-cropped4
hidden4
linear4
fp-chromecast-engine4
rotate180deg3
scale153
1px3
4em3
videofp-engine3
-ms-flex3
flowplayeris-rtl3
nowrap3
flowplayerno-flex3
scaley1353
emhover3
scale113
vertical-align3
em3
white-space3
fp-share-menu3
53
scaley063
scaley0753
fp-controlshover3
fill3
scale0953
fp-context-menu3
facebook3
fp-duration3
ec6c4c3
table3
flowplayeris-paused3
flowplayeris-mouseover3
08em3
normal3
wp-block-navigationcontainer3
10px3
imgblocks-gallery-grid3
grain3
flowplayeris-fullscreen3
e-book3
grdc3
zone3
rainfall3
low3
growers3
australian3
fp-color3
max-width3
63
scale123
inherit3
bold3
font-weight3
border-box3
24em3
ccc3
73
04em3
z-index3
28em3
033
flowplayeris-live3
fp-unload3
fp-remaining3
twitter3
fp-player3
-webkit-filter3

Actfa.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Actfa.com
Actfa School of Dance and Performing Arts Singapore - Dance Classes in Singapore Salsa, HipHop, Ballet, Jazz, Tango, Latin, Ballroom, Belly dance, Bachata
Actfa.net
Welcome to the Australian Controlled Traffic Farming Association
Actfaith.com
福德彩票 - 授权官网
Actfarm.com
HugeDomains.com - Shop for over 300,000 Premium Domains
Actfas.com
Index of /

Recently Updated Websites

Socialrevolver.com 2 seconds ago.Nataliefet.com 4 seconds ago.Professionalfincounselingjournal.com 4 seconds ago.Terrasearchpartners.com 4 seconds ago.Neofs.us 4 seconds ago.3kumbara.org 5 seconds ago.Swipenfly.info 5 seconds ago.Usft.org 5 seconds ago.Snvfoundation.org 6 seconds ago.Petsuiteretreat.com 6 seconds ago.Wizkidhosting.com 6 seconds ago.W-j.co 7 seconds ago.Textboosting.com 9 seconds ago.Smart-chip-card-solutions.com 9 seconds ago.Kunelradio.ru 9 seconds ago.Hoteldeepblue.com 9 seconds ago.Pixelplan.ru 9 seconds ago.Theforcefitness.com 10 seconds ago.Themorrises.xyz 11 seconds ago.Sinosights.com 11 seconds ago.Everettblackmouthderby.com 11 seconds ago.Betteryardsandgardens.com 11 seconds ago.Ccsffl.org 12 seconds ago.Cyprusresalesdirect.com 13 seconds ago.Greenbuyback.net 13 seconds ago.Theplumbingpros.biz 13 seconds ago.E-obs.com 13 seconds ago.Suedwestlicht.saar.de 16 seconds ago.Lavikventuresrealestate.com 17 seconds ago.Plumberauckland.co.nz 17 seconds ago.