Website Analysis Summary  |  Addiction Blog is a review of current trends in behavioral and chemical addictions. We explore all types of addictions, addiction treatment and promote
Low trust score  | 
Addiction Blog - "a" is for addiction

Trust Score
Low Trust Score
Estimated worth
Estimated daily income
Estimated monthly income
0 has a Low Trust Score, and a Statvoo Rank of F. is hosted by SoftLayer Technologies Inc. in Texas, Dallas, United States, 75201. has an IP Address of and a hostname of

The domain was registered 1 decade 5 years 2 weeks ago by , it was last modified 201 decades 9 years 3 months ago and currently is set to expire 201 decades 9 years 3 months ago.

It is the world's 108,724 most popular site among over 300 million websites. has a total of 0 backlinks. gets approximately 11,431 unique visitors a day and 76,890 pageviews per day. has an estimated worth of $115,200.
An average daily income of approximately $192, which is wroughly $5,840 per month.

Whois information for

Full Whois Lookup for Whois Lookup

Registry Domain ID: D108070871-LROR
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2016-03-24T19:26:52Z
Creation Date: 2005-11-01T18:57:01Z
Registry Expiry Date: 2021-11-01T18:57:01Z
Registrar Registration Expiration Date:
Registrar:, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientDeleteProhibited
Domain Status: clientRenewProhibited
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
Registry Registrant ID: C161727269-LROR
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Registrant Street:
Registrant Street: 14455 N. Hayden Road
Registrant City: Scottsdale
Registrant State/Province: Arizona
Registrant Postal Code: 85260
Registrant Country: US
Registrant Phone: +1.4806242599
Registrant Phone Ext:
Registrant Fax: +1.4806242598
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C161727270-LROR
Admin Name: Registration Private
Admin Organization: Domains By Proxy, LLC
Admin Street:
Admin Street: 14455 N. Hayden Road
Admin City: Scottsdale
Admin State/Province: Arizona
Admin Postal Code: 85260
Admin Country: US
Admin Phone: +1.4806242599
Admin Phone Ext:
Admin Fax: +1.4806242598
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C161727272-LROR
Tech Name: Registration Private
Tech Organization: Domains By Proxy, LLC
Tech Street:
Tech Street: 14455 N. Hayden Road
Tech City: Scottsdale
Tech State/Province: Arizona
Tech Postal Code: 85260
Tech Country: US
Tech Phone: +1.4806242599
Tech Phone Ext:
Tech Fax: +1.4806242598
Tech Fax Ext:
Tech Email: Login to show email
Name Server: NS2.LINODE.COM
Name Server: NS3.LINODE.COM
Name Server: NS4.LINODE.COM
Name Server: NS5.LINODE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of WHOIS database: 2017-10-10T05:09:05Z

Who hosts Web Server Information

Hosted IP Address:
Service Provider:SoftLayer Technologies Inc.
Hosted Country:United StatesUS
Location Latitude:32.7831
Location Longitude:-96.8067
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 12 Jul 2015 09:22:33 GMT
Server: Apache/2.2.22 (Ubuntu)
X-Powered-By: PHP/5.3.10-1ubuntu3.13
Link:; rel=shortlink
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 11157
Content-Type: text/html; charset=UTF-8

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:10
Drug Courts in Mississippi
Xanax Detection Timelines (INFOGRAPHIC)
Methadone Clinics in Texas
Traveling and Planning for Rehab in Rhode Island
How To Party Without Mixing Alcohol And Drugs
Valium Detection Timelines (INFOGRAPHIC)
The Child Welfare System and Addiction in Nevada
Addiction and Child Custody Laws in Texas
Alarming Facts About Teens and Drug Use
Drug Courts in California
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:1
Total Images:32
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

setcandrughereaddictionvicodinsettingthesemollyexpectweusemoreaddiction treatmenthelplinehelpdependencerecoveryhelplinevicodin rehabmethcocaineoctober2017aprivateinfographicsquotesavailablelovedwithdrawallookaddictionblogorgtriggersalcoholrehabposterany1yourseptemberaddiction recoverylearndiscussyouhelplinehelp available0lifetreatmentyou canspiceadderallreviewhelpsymptoms

Longtail Keyword Density for

addiction treatment5
addiction recovery4
helplinehelp available3
vicodin rehab3
you can3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry