Adidas.co.uk  |  adidas Online | Be The Difference
Low trust score  | 
Be The Difference. Discover the new adidas football with X and ACE. Shop shoes and clothing of adidas Football, Originals, Running, Training and more.




Adidas.co.uk Website Information

Website Ranks & Scores for Adidas.co.uk

Statvoo Rank Statvoo Rank:C
Alexa Rank Alexa Rank:10,196
Majestic Rank Majestic Rank:33,406
Domain Authority Domain Authority:61%
DMOZ DMOZ Listing:No

Whois information for adidas.co.uk

Full Whois Lookup for Adidas.co.uk Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Adidas.co.uk. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain name:
adidas.co.uk

Registrant:
adidas AG

Registrant type:
Non-UK Corporation

Registrant's address:
Alberto Pedraz
Adi-Dassler-Platz 1 - 2
Herzogenaurach
91074
Germany

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 27-Aug-2015

Registrar:
RegistryGate GmbH [Tag = REGISTRYGATE-DE]
URL: http://www.registrygate.com

Relevant dates:
Registered on: 27-May-1997
Expiry date: 27-May-2018
Last updated: 26-May-2017

Registration status:
Registered until expiry date.

Name servers:
sec1.rcode0.net
sec2.rcode0.net

WHOIS lookup made at 04:52:13 16-Aug-2017

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts Adidas.co.uk?

Adidas.co.uk is hosted by Equinix (Germany) GmbH in Germany.
Adidas.co.uk has an IP Address of 89.202.119.242 and a hostname of 89.202.119.242.



Adidas.co.uk Web Server Information

Hosted IP Address:89.202.119.242
Hosted Hostname:89.202.119.242
Service Provider:Equinix (Germany) GmbH
Hosted Country:GermanyDE
Location Latitude:51
Location Longitude:9
Webserver Software:Not Applicable

HTTP Header Analysis for Adidas.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 12 Jun 2015 21:10:35 GMT
Server: Demandware eCommerce Server
Cache-Control: no-cache,no-store,must-revalidate
Pragma: no-cache
Expires: Thu, 01 Dec 1994 16:00:00 GMT
Vary: Accept-Encoding
Content-Encoding: gzip
Accept-Ranges: bytes
Content-Length: 23312
Content-Type: text/html;charset=UTF-8


Need to find out who hosts Adidas.co.uk?

Adidas.co.uk Free SEO Report

Website Inpage Analysis for Adidas.co.uk

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Adidas.co.uk

accessories allswimmingfeatured new arrivalscookiesflip flopstennisfeaturedthroughpleaseproductsfeatured newadidas neotshirtsfliptop sellersweightliftingsellerscyclingmayadidasarrivalscontactshoesjerseyswe mayoutdoorsboostadidas productspromotionsnbspwegolfcheckyourfootballourif yououthaveweeks top sellersaccessories newalldesignemailpostweeks toptopaccessoriesbagsaccessories new arrivalsbasketballrugbyall menskidsoriginalsgirlssportsxyouclothing accessoriesmoreordersclothing accessories newhockeynmdall womensnew arrivalspharrellrunningifrunning trainingtopsotheroutlettrainingweeksflopsfootball runningcreateneoeqtmensboysboxingall adidasnewnotmay contactcustomisedwomensshoes clothing accessoriesshoes clothingclothing

Longtail Keyword Density for Adidas.co.uk

KeywordsOccurences
shoes clothing accessories6
accessories new arrivals3
clothing accessories new3
featured new arrivals3
weeks top sellers3
new arrivals8
clothing accessories7
shoes clothing6
all mens6
all womens6
accessories all4
running training4
may contact3
we may3
adidas products3
accessories new3
all adidas3
featured new3
weeks top3
football running3
if you3
adidas neo3
flip flops3
top sellers3
all32
clothing18
adidas18
shoes17
accessories15
your15
you15
we14
football11
running11
training10
sports10
basketball9
womens8
mens8
new8
arrivals8
golf6
our6
bags5
tennis5
originals5
boxing5
may5
products5
x5
nbsp5
kids4
have4
boys4
girls4
please4
boost4
eqt4
swimming4
customised4
rugby4
contact4
through4
orders4
hockey4
weightlifting3
cycling3
outdoors3
tops3
jerseys3
t-shirts3
design3
pharrell3
more3
promotions3
email3
post3
out3
if3
not3
cookies3
check3
create3
other3
outlet3
neo3
flip3
nmd3
sellers3
featured3
weeks3
top3
flops3

What are the nameservers for adidas.co.uk?

Adidas.co.uk Domain Nameserver Information

HostIP AddressCountry
dns.noris.ch 194.31.2.65Germany Germany
dns.noris.de 192.109.102.65Germany Germany
dns.noris.net 213.95.0.65Germany Germany

Adidas.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Adidas.co.uk is a scam?