Adscpm.net  |  Adscpm Popunder Network
High trust score  | 
Adscpm.net is best pop under ad network in a online industry . try it and see the rates and performance of our network.

Adscpm.net Website Information

Adscpm.net has a High trust score, a Statvoo Rank of A, an Alexa Rank of 837, a Majestic Rank of 0, a Domain Authority of 12% and is not listed in DMOZ.

Adscpm.net is hosted by CloudFlare, Inc. in California, Los Angeles, United States, 90001.
Adscpm.net has an IP Address of 162.159.250.36 and a hostname of 162.159.250.36.

The domain adscpm.net was registered 6 years 2 weeks 5 days ago by , it was last modified 4 years 6 months 49 minutes ago and currently is set to expire 3 years 3 weeks 1 day ago.


Whois information for adscpm.net

Full Whois Lookup for Adscpm.net Whois Lookup

Domain Name: ADSCPM.NET
Registry Domain ID: 1828142395_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.domain.com
Registrar URL: http://www.domain.com
Updated Date: 2017-07-28T04:04:33Z
Creation Date: 2013-09-19T14:20:11Z
Registry Expiry Date: 2018-09-19T14:20:11Z
Registrar: Domain.com, LLC
Registrar IANA ID: 886
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: 602-226-2389
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: BEN.NS.CLOUDFLARE.COM
Name Server: GINA.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-09-13T23:26:03Z

Who hosts Adscpm.net?

Adscpm.net Web Server Information

Hosted IP Address:162.159.250.36
Hosted Hostname:162.159.250.36
Service Provider:CloudFlare, Inc.
Hosted Country:United StatesUS
Location Latitude:34.0522
Location Longitude:-118.244
Webserver Software:Not Applicable

HTTP Header Analysis for Adscpm.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 06 Jul 2015 04:03:54 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/5.4.38
Server: cloudflare-nginx
CF-RAY: 20186c2764ed135f-LHR
Content-Encoding: gzip


Need to find out who hosts Adscpm.net?

Adscpm.net Free SEO Report

Website Inpage Analysis for Adscpm.net

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Adscpm.net

0throughdailyservicestrafficsystemtimepopuprateswesitesmobilestatsalsonetwork

Longtail Keyword Density for Adscpm.net

KeywordsOccurences
popup7
traffic7
system6
network4
services4
also3
through3
03
daily3
sites3
time3
rates3
we3
stats3
mobile3

What are the nameservers for adscpm.net?

Adscpm.net Domain Nameserver Information

HostIP AddressCountry
ben.ns.cloudflare.com 173.245.59.103United States United States
gina.ns.cloudflare.com 173.245.58.117United States United States

Adscpm.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Adscpm.net is a scam?