Agilito.pl  |  ΞΞ Agilito ΞΞ ☎ Pozycjonowanie Stron Internetowych w Google, Skuteczna Reklama w Internecie Poznań - Tanie pozycjonowanie www
Low trust score  | 
Agilito Poznań to tanie ✔ i skuteczne ✔ pozycjonowanie stron internetowych WWW w wyszukiwarce Google! Pozwól się znaleźć dzięki pozycjonowaniu i poszerz grono swoich Klientów. Firma Agilito z Poznania zaprasza!




Agilito.pl Website Information

Website Ranks & Scores for Agilito.pl

Statvoo Rank Statvoo Rank:F
Alexa Rank Alexa Rank:118,205
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:25%
DMOZ DMOZ Listing:No

Domain Information for Agilito.pl

Domain Registrar: NASK
Registration Date:2011-03-26  8 years 2 months 3 weeks ago
Last Modified:2014-02-14  5 years 4 months 5 days ago

Whois information for agilito.pl

Full Whois Lookup for Agilito.pl Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Agilito.pl. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

request limit exceeded

Who hosts Agilito.pl?

Agilito.pl is hosted by Hetzner Online GmbH in Germany.
Agilito.pl has an IP Address of 46.4.83.114 and a hostname of s76.linuxpl.com.



Agilito.pl Web Server Information

Hosted IP Address:46.4.83.114
Hosted Hostname:s76.linuxpl.com
Service Provider:Hetzner Online GmbH
Hosted Country:GermanyDE
Location Latitude:51
Location Longitude:9
Webserver Software:Not Applicable

HTTP Header Analysis for Agilito.pl

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 16 Jul 2015 14:11:41 GMT
Server: Apache
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html


Need to find out who hosts Agilito.pl?

Agilito.pl Free SEO Report

Website Inpage Analysis for Agilito.pl

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Agilito.pl

znaczenieoptymalizacjareklama wniejejwynikwadwordsstronpastwaagilito spsagilito sp zstronastronypozycjonowanie stronprzypadkutaketakiesponsorowanychkampanii adwordsdladoeusugreklamsp z ooodsiwyszukiwaniazmarkiktreokampanieorazofertyjestmanafirmyreklamakampaniilinkiwicsi wmidzy innymispsi zlubpocolinkwchcemysponsorowanemidzypozycjonowanieooofertabywzadlategolinkw sponsorowanychprzeznasofertasi nasiecisp zgoogletakagencjaagilitolinki sponsorowaneseoteswojczyliwyszukiwarekinternetowychz oo0pastwoinnymimonauytkownikw

Longtail Keyword Density for Agilito.pl

KeywordsOccurences
sp z oo5
agilito sp z5
z oo5
agilito sp5
sp z5
si na3
midzy innymi3
si z3
linkw sponsorowanych3
reklama w3
kampanii adwords3
pozycjonowanie stron3
linki sponsorowane3
si w3
w39
na22
si22
z18
stron11
adwords10
pozycjonowanie10
google10
dla8
strony8
do7
o7
ofert6
od6
agilito6
firmy6
seo6
usug6
nie5
jest5
ktre5
po5
dlatego5
sp5
przez5
oo5
linkw4
mona4
za4
jej4
marki4
kampanii4
uytkownikw4
s4
oferty4
take4
aby4
pastwo3
tak3
e3
ma3
wic3
pastwa3
lub3
czyli3
03
reklam3
te3
wynikw3
nas3
swoj3
wyszukiwania3
strona3
oraz3
kampanie3
sponsorowanych3
sieci3
linki3
optymalizacja3
reklama3
sponsorowane3
oferta3
przypadku3
znaczenie3
midzy3
innymi3
takie3
co3
internetowych3
agencja3
wyszukiwarek3
chcemy3

What are the nameservers for agilito.pl?

Agilito.pl Domain Nameserver Information

HostIP AddressCountry
ns11.linuxpl.com 176.9.79.79Germany Germany
dns11.linuxpl.com 78.46.37.186Germany Germany

Agilito.pl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Agilito.pl is a scam?