Website Analysis Summary  |  Ai Dreams
Low trust score  | 
Ai Dreams

Trust Score
Low Trust Score
Estimated worth
Estimated daily income
Estimated monthly income
0 has a Low Trust Score, and a Statvoo Rank of G. is hosted by in . has an IP Address of and a hostname of .

The domain was registered 10 months 2 weeks 1 day ago by , it was last modified 10 months 2 weeks 1 day ago and currently is set to expire 10 months 2 weeks 1 day ago.

It is the world's 449,919 most popular site among over 300 million websites. has a total of 0 backlinks. gets approximately 2,934 unique visitors a day and 8,802 pageviews per day. has an estimated worth of $9,360.
An average daily income of approximately $26, which is wroughly $791 per month.

Whois information for

Full Whois Lookup for Whois Lookup

Domain name:

Data validation:
Nominet was not able to match the registrant's name and/or address against a 3rd party source on 26-Nov-2016

Fasthosts Internet Ltd [Tag = LIVEDOMAINS]

Relevant dates:
Registered on: 05-Jan-2007
Expiry date: 05-Jan-2020
Last updated: 06-Dec-2018

Registration status:
Registered until expiry date.

Name servers:

WHOIS lookup made at 15:46:48 06-Apr-2019

This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2019.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts Web Server Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Not Applicable
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 06 Apr 2019 14:46:46 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Pragma: no-cache
Cache-Control: private
Vary: Accept-Encoding
Content-Encoding: gzip
X-Powered-By: PleskLin
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:21
Why the NEW Blender 2.8 is a Big Deal... in Graphics and Video Software
How to verify that quantum chips are computing correctly in Robotics News
XKCD Comic : JPEG2000 in XKCD Comic
NEON - Artificial Humans in Avatar Talk
are there any benefits to an AI having a mourning skill ? in General AI Discussion
goaty reporting in in Future of AI
Missing "Like" option. in Forum problems etc
How well can computers connect symptoms to diseases? in Robotics News
XKCD Comic : Star Wars Voyager 1 in XKCD Comic
beyond omega level coding in General AI Discussion
The AvatarBot in Tools
Eva in Chatbots - English
Star Wars: Episode IX – The Rise of Skywalker in Robots in Movies
Terminator: Dark Fate in Robots in Movies
Life Like in Robots in Movies
I Am Mother in Robots in Movies
Mitsuku wins 2019 Loebner Prize in Articles
Metal Gear Series - Metal Gear RAY in Robots in Games
Fallout 3 - Liberty Prime in Robots in Games
Building Chatbots with Python in Books
Voicebot and Chatbot Design in Books
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:3
Total Images:27
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

robots in gamesscience and artificialsharethoughtarticleopenworldsnextbeenprojectvisualwouldfrequencyoverallrespondstartedopenagleadveryselfagainstmitgeneral chatcompoundsthanplantfirstgettinggear rexhuman1durationbeingsuchextremelybuildinitiativehandlightbasil plantschatbotsusmakinghedgehogstreamsorderanyforumusedmetal gearbasilstatetechnologiesstringwhichunderstandusemighthigherjustchatagriculturalgeneratedmanymachine learningeveryplants underresearchersfuturebooklablanguagecharacterthroughmyunderthenlearnlastproduceplayableintelligencesystemsconnectomehelpshouldprogressthemgrownforcessmallparrayou havebotslearningcrisprknowledgecreatedinvolvedagiconversationalenvironmentmodellikeseriesso far05tastecsailsensesnotsynapsefrequencyestimationthinkalexaplatformsresultsenvironmentalnowactuallypmonlywethingsdestroyedconversational uishadsomegamestylerinternetallappearslackmetal gear rexcropsmarprobleminterfacesattentiontakesmeaningfuldevelopedprofessoruisseeoutdecidedfindautomaticallyhasgearmit newsslave zerowaycomputer sciencetheremuchreal timelikelyfarsimilarlookexampleworldwellrobotsspecialdowngeneralit039sitsteamalgorithmonelevelsmoreiptemporalalsowerecomments startedhemelevelflavorrealimaginationcouldmessengerthesestartingapproacheffectsbraingooglebucketroboticsdnagroupdesignaprcomenetworkbuildingtoolsincludingharper sayspopularhighamazon alexaartificial intelligenceshowdoesworkingnatural languageglitchgetrecognisingcontrolledevenformstarted todaybecausetheybetterifharperconditionssoexperiencesgames metalmitsuser interfacesverbatimprocessingmachinesourbuttakevideosgrowpapercommentsvoicemachinefunctionmatchintelligence laboratorycomingdesignedpointmy agipercentartiveideassearchexperienceagestarted april 05technologypropertiesdifferenttodaystorynetworkslittletraditionalideacangoogle homepm tylerbehindwhilewe canelementsartificialsystemagriculturepossibleshortsaysaiwebtimeintostoredbothpatternscomplexrecognisematchingdevelopmenteachsonicalgorithmsnoendapril 05discovermedia labneuroncomputerotherlearnedsketchusesgrowingpartcognizantplantsstillyoutheirmostenvironmental conditionslaunchcortexapril 2019fulgore39sratheryearsinterestedbestdigitalowndatacomputerszerowordsaprilfilmbooksinformationresearchmultiplecompaniesdata streamsamazonlaboratory csailspecifichavestudyinterestingwholefacebookmetal sonicgamedevelopgoodlaboratoryneuralamountmediahomeever0april 05 2019naturalnbspiunder controlledinputfoundchemicaldotrafficheresoftwarescienceeditetcnewsfacebook messengerknownslavelearnsnbspdoneengineerhispatternuserstarted aprilsinceintelligence laboratory csailusingareasfewitemsrexspeechwork05 2019robotmethodcontrolled environmentalmetalvisual cortexfulgoreartificial intelligence laboratorylearnedtopbeforerunningnew

Longtail Keyword Density for

robots in games6
started april 054
april 05 20194
science and artificial3
artificial intelligence laboratory3
intelligence laboratory csail3
metal gear rex3
machine learning11
metal gear8
mit news6
metal sonic6
artificial intelligence6
05 20195
started today4
we can4
facebook messenger4
environmental conditions4
computer science4
visual cortex4
natural language4
you have4
april 054
started april4
user interfaces3
games metal3
google home3
amazon alexa3
slave zero3
data streams3
real time3
conversational uis3
so far3
my agi3
laboratory csail3
intelligence laboratory3
general chat3
controlled environmental3
under controlled3
plants under3
harper says3
basil plants3
media lab3
april 20193
pm tyler3
comments started3
gear rex3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry