Airbnb: aluguéis por temporada, cabanas, casas de praia, acomodações e experiências únicas

Safety: Low trust score
Year Founded: 2010
Global Traffic Rank: 37,482
Estimated Worth: $259,920

Encontrar locações por temporada, cabanas, casas de praia, acomodações e experiências únicas no mundo todo — anfitriões fazem acontecer no Airbnb.



Domain summary

Last updated
2021-05-16
Domain label
airbnb
Domain extension
com.br
Domain registered:
2010-06-17
Domain updated:
2019-05-31
Domain expires:
2021-06-17
Global Traffic Rank
37,482
Statvoo Rating
D
Trust Score
Low Trust Score
Estimated worth
$259,920
Estimated daily income
$361
Estimated monthly income
$10,980

Frequently Asked Questions (FAQ)

Q: When was Airbnb.com.br registered?
A: Airbnb.com.br was registered 11 years, 4 days, 13 hours, 26 minutes, 19 seconds ago on Thursday, June 17, 2010.
Q: When was the WHOIS for Airbnb.com.br last updated?
A: The WHOIS entry was last updated 2 years, 3 weeks, 13 hours, 26 minutes, 19 seconds ago on Friday, May 31, 2019.
Q: What are Airbnb.com.br's nameservers?
A: DNS for Airbnb.com.br is provided by the following nameservers:
  • dns4.p01.nsone.net
  • dns3.p01.nsone.net
  • dns2.p01.nsone.net
  • dns1.p01.nsone.net
Q: Who is the registrar for the Airbnb.com.br domain?
A: The domain has been registered at BR-NIC.
Q: What is the traffic rank for Airbnb.com.br?
A: Airbnb.com.br ranks 37,482 globally on Alexa. Airbnb.com.br has a Low Trust Score, and a Statvoo Rank of D.
Q: How many people visit Airbnb.com.br each day?
A: Airbnb.com.br receives approximately 30,096 visitors and 180,576 page impressions per day.
Q: What IP address does Airbnb.com.br resolve to?
A: Airbnb.com.br resolves to the IPv4 address 3.215.205.65.
Q: In what country are Airbnb.com.br servers located in?
A: Airbnb.com.br has servers located in the United States.
Q: What webserver software does Airbnb.com.br use?
A: Airbnb.com.br is powered by Nginx webserver.
Q: Who hosts Airbnb.com.br?
A: Airbnb.com.br is hosted by AMAZON-AES in Virginia, Ashburn, United States, 20149.
Q: How much is Airbnb.com.br worth?
A: Airbnb.com.br has an estimated worth of $259,920. An average daily income of approximately $361, which is roughly $10,980 per month.

Airbnb.com.br Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Airbnb.com.br Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Airbnb.com.br

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

4 :
  1. Sobre
  2. Comunidade
  3. Anfitrião
  4. Atendimento

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

37:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Airbnb.com.br

por favor tenteimportanttextdecorationnone importantwebkituserselectautoimportantwebkitalignitemsvaracmdtcalignitems flexstart importantalignitemsvaracmdtcalignitemsease 20ms pointereventsimportanttextaligncenterimportantbackgroundtransparent0px 0pxanos ouadicionais seroimportantmsflex1 1varhclgwidthvertemporadaimportantmozuserselectauto importantmsuserselectautoimportanttextaligninherit importanttextdecorationnone importantwebkituserselectautoimportantwebkitalignitemsvaracmdtcalignitems0px 4px 222222importantpositionrelative importantzindex1importantwidth383px2pxtodo222222 importantmedia prefersreducedmotionimportantmargin0pximportantdisplayinlineblock importantwebkitanimationnamekeyframe1cjd84a importantanimationnamekeyframe1cjd84ado1375 translatey58pximportantalignitemsvaraclgtcalignitemsease transform 01simportantmozappearancenone importantappearancenone importantbackgroundtransparentemimportantmsflex1sentence max 20em suamundo todo anfitriesumalabelimportantcliprect0 0 0flexstart importanttextalignvaracsmtctextaligneasetransform 150mscaractere por favorimportantwebkitanimationiterationcountinfinite importantanimationiterationcountinfiniteimportantmarginright4pxdatasimportantcontent importantdisplaynoneimportantdisplaymsflexbox importantdisplaywebkitflex importantdisplayfleximportantwidth100 importantzindex1importantwebkitflexdirectioncolumn importantmsflexdirectioncolumn importantflexdirectioncolumnimportantwebkitappearancenoneimportantboxshadow0px 0pxaluguisest0mspraia acomodaesimportantwebkitalignitemsvaracsmtcalignitems flexstartimportantalignitemsvaraclgtcalignitems flexstart importanttextalignvaraclgtctextalignimportantwebkitanimationfillmodebothimportantboxshadowinsetpageimportantflexdirectioncolumn importantwidth280pxnoiteda viagemimportantpaddingright80px importantmedia minwidthmelhor daimportantmargintop16px importantpositionabsoluteflexstart importantmsflexalignvaracsmtcalignitems flexstartimportantwidth338px importantwebkitalignitemsvaracmdtcalignitems0 0 importantmsflex1para ver o0 importantmsflex1 0importantoverflowvisible importantpadding12pximportantmsflex0importantfontweightinherit importantlineheightinherit importantmargin0pximportantdisplaywebkitinlineflexmelhor danaturezasugestesmaxwidth cubicbezier035 0importantlineheight18px importantfontweight600auto importantmsflex0importantoverflowhidden01flexstart importantalignitemsvaraclgtcalignitems flexstartimportantalignitemsvaracmdtcalignitems flexstart importanttextalignvaracmdtctextalignimportantborder0pxauto importantflex0importantcontent importantdisplaynone importantheight32px2px ffffffright e61e4d 0suggestionimportantleft0pximportantwebkittransitionboxshadow 02simportantwhitespacenowrapimportantwebkitclippathinset100 importantclippathinset100importantmsflexalignvaraclgtcalignitems1 varhcmdwidth 10px 0px 2px4px ffffff importantmediaopacity easeimportantwebkitalignitemscenterimportantmstransformorigin50smartcountperfilsenha deve terdinheiroimportantdisplaymsinlineflexbox importantdisplaywebkitinlineflex importantdisplayinlineflex0 0 importantwebkitclippathinset100importantoutlinenone importantoverflowvisibleimportantdisplaymsflexbox importantdisplaywebkitflexluxeimportantwebkitboxorientverticalimportantwebkitappearancenone importantmozappearancenone importantappearancenoneimportantflex0importantalignitemscenter importantdisplaywebkitbox importantdisplaymozboximportantright0px importanttop0pximportantwebkitflex0 0importantmsflex1 0 0importantclippathinset100 importantheight1pxbebsimportantzindex0importantpositionabsolute importantwhitespacenowrapimportantcursorpointerimportantheight6px importantmarginright4pxver oimportantmsflex0 0importantboxshadow0px 0px 0pxdaimportantcliprect0para estadiasimportanttextalignvaracmdtctextalign100vwum erroimportantverticalalignmiddleimportantborder1px solid transparentseuautovarhcsmwidth150ms ease opacitycubicbezier035 0 065importantwebkitanimationnamekeyframe1cjd84a importantanimationnamekeyframe1cjd84asolid transparent importantborderradius32pxrgba0importantwebkitboxorientvertical importantdisplaywebkitboximportantborderradius100importantwebkitclippathinset100 importantclippathinset100 importantheight1pximportantmsuserselectauto importantuserselectauto065 1importantmsflexaligncenter importantwebkitalignitemscentero airbnbimportantflex1importantmsflex1 05acharame experincias nicaslocaes porbottomanfitriesimportantlineheight16px1 importantmoztransition02sfrente para8pximportantlineheightinherit importantmargin0pximportantheight32px0ms 150mspointerevents 0msosimportantheight6pxease importantmoztransitionboxshadow 02s1 importanttransition02spartirtodasatrssmartcountstrdostransform 01simportantalignitemsvaracmdtcalignitemsdanaturezasugestes de favoritosmoradoresimportantminwidth0px importantpositionrelativebar20ms visibility40pximportanttop0px importantzindex0importanttop50 importantzindex0importantwidth6px importantheight6px importantmarginright4pximportanttextdecorationunderlinetransparent0 140pximportantalignitemsvaraclgtcalignitems flexstart01 102s transform16 100vwesta dicaimportantappearancenone importantbackgroundtransparent importantborder0px02s ease importantmoztransitionboxshadowimportantmsflexdirectioncolumnpor favorter3importantwebkitalignitemscenter importantalignitemscenter102s transform cubicbezier0importantclippathinset100o preoimportantanimationiterationcountinfinite importantwebkitanimationtimingfunctionlinear02s ease importantboxshadowinseteimportantbottom0px1px importantborderstylesolid importantbordercolorvarbigsearchformbackgroundimportantmargin0px importantpadding0pximportantflex0 0importantborderradius32px222222 0px 0px4 varhcsmwidth 30 importantmediaumno podeimportantfontstyleinherit importantfontvariantinheritaoimportantwebkitanimationiterationcountinfinite importantanimationiterationcountinfinite importantwebkitanimationtimingfunctionlinearpode0em importantlineheightvartllineheightpessoascrianasimportantmargin0importantleft0px importantpositionabsoluteimportantpositionabsolute importantright0px importanttop0pximportantmsflexaligncenterimportantwidth280px importantwebkitalignitemsvaracsmtcalignitems flexstartimportantbackgroundtransparent importantborder0px0 32importantfontweight400importantflexdirectioncolumnddddddimportantpaddingright40pxviagensmaisimportantdisplaymozbox importantdisplaymsflexbox importantdisplaywebkitfleximportantpadding0px importanttextaligninherit importanttextdecorationnonealuguis porsemtemporada cabanas casasimportantfontweightvartlfontweighteaseopacity 50ms ease0px 1px 222222airbnb luxeease importanttransitionboxshadow 02snomeimportantmsflexaligncenter importantwebkitappearancenoneimportantlineheightinheritimportantpositionabsolute importantwhitespacenowrap importantwidth1pximportanttextdecorationnoneease importantboxshadow0px 0px2px ffffff 0pximportantpointereventsautodo airbnb0000 importantmsflex1importantalignitemsvaracsmtcalignitems flexstartimportantwebkitflex0ease importantboxshadowinset 0px2px 222222viagemimportantwebkitanimationnamekeyframe1cjd84a importantanimationnamekeyframe1cjd84a importantwebkitanimationduration08simportanttextalignvaraclgtctextalign start importantmediaimportantfontvariantinherit50ms ease 20msimportantcursorpointer importantdisplaywebkitbox importantdisplaymozboxopodemdefromendflexstart importantwebkitboxdirectionnormal importantwebkitboxorientverticalmenosimportanttextdecorationnone importantwebkituserselectauto importantmozuserselectautolandingdata0px 0px 4pximportantzindex0 importantwebkitflexdirectioncolumn9 varhclgwidth 16opacityimportantanimationiterationcountinfinite importantwebkitanimationtimingfunctionlinear importantanimationtimingfunctionlinearvarhcsmwidth 3importantfontsizeinherit importantfontweightinherit importantlineheightinherit0px 4pxrgba0 0 0ease importanttransitionboxshadowwebkittransform23 100vwtitlesmartcountstr caracterevarhcmdwidth 1importantmsflexalignvaracmdtcalignitems flexstartimportantborderstylesolid0 importanttransformorigin50importanttop0pximportantwebkitanimationfillmodeboth importantanimationfillmodebothimportantanimationduration08simportantlineheight18pxminwidthimportantmedia prefersreducedmotionvarhcsmwidth 3 100vwimportantcliprect0 0importantdisplaymozinlinebox importantdisplaymsinlineflexboximportantwidth338px importantwebkitalignitemsvaracmdtcalignitems flexstart000 rgba0 0importantanimationnamekeyframe1cjd84a importantwebkitanimationduration08s0 0pxtransform cubicbezier0importantcursorpointer importantdisplaywebkitboximportantdisplaywebkitinlinebox importantdisplaymozinlinebox importantdisplaymsinlineflexboximportanttextalignleftimportantwebkitboxorientvertical importantdisplaywebkitbox importantdisplaymozboximportantmargintop16pxcomoimportantborderradius100 importantdisplayinlineblocktelefone0px 2pxopacity cubicbezier035copy150ms easeimportantmsflexdirectioncolumn importantflexdirectioncolumn importantwidth280pximportanttextalignvaracmdtctextalign start importantmediaimportantcolor2222221px 222222importantletterspacingvartlletterspacing 0em importantlineheightvartllineheightimportantfontsizeinheritimportantbackgroundcolorffffffimportantfontweight600max 20importantbordercolorvarbigsearchformbackground transparenttransform 01s easeresposta1 varhcmdwidth4algumasimportantmarginright4px importantborderradius100caracteresimportantwebkitboxdirectionnormaldatas parasolid transparente61e4d 0 e31c5fimportantwebkittransitionboxshadowno mximoflexstart importantmsflexalignvaraclgtcalignitemsflexstart importantalignitemsvaraclgtcalignitems000 rgba0seta paracubicbezier035importantmozuserselectauto importantmsuserselectauto importantuserselectautoflexstartsenha no podevoc estmximo0px 0px 1pximportantpaddingright40px importantmedia minwidthbottom 000importantcolorinheritimportanttop50start0 0cubicbezier0 0 01importantmozuserselectautocaractere0px 4px ffffffmaxtotalresults0px 0px 0px0 0 0importanttextalignvaracsmtctextalign start8pontoacharam esta dicamodalpartir defromend0 importantmstransformorigin50 0importantdisplayfleximportanttextalignvaracsmtctextalign start importantmediataxas adicionaisimportantheight1px importantoverflowhidden importantpadding0pxtranslate60px 122pximportantanimationtimingfunctionlinearimportantcolorvartlcolorease transformtotal daimportantpaddingright80px importantmediapara verimportantdisplaywebkitinlineflex importantdisplayinlineflex24pximportantwidth280pximportantpaddingright80pximportantmoztransitionboxshadow 02spointerevents 0ms 150msconfiguraes de contaimportantwidth6px importantheight6pxonde0 e31c5f 500px 2px 222222importantwebkitflex1h smartcountstrimportantflexdirectioncolumn importantwidth280px importantwebkitalignitemsvaracsmtcalignitemsimportantoutlinenoneestadiaacessarimportantmoztransitionnone20ms visibility 0msimportantbordercolor222222rgba0 0importantwidth100importantsupports1 autoimportantbordercolor222222 importantboxshadow0pximportantdisplaymsinlineflexboximportanttextoverflowellipsisimportantlineheight18px importantmargin0pxmaxconfiguraesimportantwebkitanimationtimingfunctionlinear importantanimationtimingfunctionlinear importantwebkitanimationfillmodeboth0px 2px fffffftemporada cabanasimportantopacity00 065 10 autoimportantmediaimportantalignitemscentermaxwidth cubicbezier035importantfontsize14px importantlineheight18pximportantuserselectauto1px importantborderstylesolidou01 102shost7maslugares paralocaesimportantalignitemscenter importantdisplaywebkitboxwebkittransform cubicbezier0 0importantmargintop16px importantpositionabsolute importantright0pximportantmsflexalignvaracsmtcalignitems flexstart4px 222222 importantmediaimportantright0px importanttop50 importantzindex00 01 1e61e4d 0importanttop0px importantwidth10020ms pointereventsimportantmozappearancenone importantappearancenonever o preoimportantwidth280px importantwebkitalignitemsvaracsmtcalignitemsease importantbordercolor222222 importantboxshadow0pxbottom 000 rgba0opacity 50ms02s ease importantbordercolor222222significa que0pximportantwebkitanimationduration08simportantbottom0px importantcontentdiaimportantpadding12pximportantmsflexaligncenter importantwebkitappearancenone importantmozappearancenoneimportantborderstylesolid importantbordercolorvarbigsearchformbackgroundmstransformimportantheight80pximportantwidth383px importantwebkitalignitemsvaraclgtcalignitemspodem ser1375 translate60px 122pxwebkittransform cubicbezier0ease opacitytotalno mundoimportantmsflexdirectioncolumn importantflexdirectioncolumnimportantwebkittransition02svoconde voccasaspara acessaradicionais sero aplicadasimportanttransformorigin50deve ter noimportantwebkitalignitemsvaraclgtcalignitemsnmero de telefonesero aplicadasimportantdisplaynone importantheight32pxeasetransform 150ms easesolid ddddddtranslatey58pximportanttextalignvaracsmtctextaligntodo anfitries fazemimportantdisplaywebkitflex importantdisplayflex importantfontfamilyinheritffffff importantmediaimportantmargin1pximportantwebkitanimationnamekeyframe1cjd84a02s easeimportantwebkitalignitemsvaraclgtcalignitems flexstartimportantmargin0px importantoutlinenone01s easecentersenha deveimportantboxshadow0pximportantborderradius32px importantbottom0px importantcontentimportantwebkitflex1 0 0estadiasimportantappearancenone importantbackgroundtransparentimportantdisplaymozboximportantmaxwidth100 importantfontsizevartlfontsizesuasdatas para ver0 importantflex1 0anfitries fazemdanaturezasugestesda suaimportantmaxwidth100importantwebkituserselectauto importantmozuserselectautoimportantwidth383px importantwebkitalignitemsvaraclgtcalignitems flexstartpelo menosimportantmoztransitionboxshadow 02s ease6pxcaracteres por favorflexstart importanttextalignvaracmdtctextalignimportantheight100cabanasimportantwebkitalignitemsvaraclgtcalignitems flexstart importantalignitemsvaraclgtcalignitemster no mximomundoo preo totalcubicbezier035 0importantanimationnamekeyframe1cjd84aimportantmoztransitionboxshadowpelotranslate60pximportantwebkitalignitemscenter importantalignitemscenter importantdisplaywebkitbox0 importantflex1textacontecerimportantpadding10pxtaxaimportantdisplaywebkitflexhcubicbezier0smartcountstr caracteresimportantlineheight18px importantmargin0px importantoutlinenone0 importantwebkitclippathinset100 importantclippathinset1004 varhcsmwidthimportantpositionabsoluteease importantmoztransitionboxshadow0emmin85vhease importantboxshadowinsetimportantpositionrelativeexperinciasimportantcontent importantleft0px4px102s transformserosetaimportantdisplaywebkitflex importantdisplayflex importantwebkitflex1msflexstart importantalignitemsvaracsmtcalignitems4px 222222caractere porimportantanimationnamekeyframe1cjd84a importantwebkitanimationduration08s importantanimationduration08spara140pximportantpadding0px importantpositionabsoluteter pelo menostodo anfitriesimportantfontweight400 importantpadding10pximportantwidth6px9 varhclgwidthsenha no0 01importantfontfamilyinherit importantfontsizeinherit importantfontweightinheritimportantwebkitanimationiterationcountinfiniteimportantwebkituserselectautocasas de praiaimportantmsflexalignvaracmdtcalignitemsserimportantdisplayinlineblockimportantpositionabsolute importantright0pximportantwebkitanimationfillmodeboth importantanimationfillmodeboth importantverticalalignmiddleimportanttransition02ssenhaimportantpositionrelative importantwidth100visibilityimportantpadding0px importantpositionabsolute importantwhitespacenowrapacomodaes etransform cubicbezier0 0que voc este31c5f 50 d70466queimportantleft50itensimportantmsflexaligncenter importantwebkitalignitemscenter importantalignitemscenterpointereventsqualquerimportantboxshadowinset 0px 0pxfazem acontecer0 importanttransformorigin50 0importantdisplaywebkitflex importantdisplayflex150ms easetransformimportantanimationduration08s importantwebkitanimationiterationcountinfinite importantanimationiterationcountinfiniteimportantpadding0px importanttextaligninheritmximo smartcountstr caracteresimportantfontsizeinherit importantfontweightinheritvarhcmdwidthairbnbimportanttransitionboxshadow 02s easeimportantmedia minwidthnicasimportanttextalignvaracmdtctextalign startcaracteres pormelhorimportantpaddingright24pximportantwhitespacenowrap importantwidth1pxflexstart importantmsflexalignvaracmdtcalignitems flexstartimpostosimportantanimationiterationcountinfiniteestasua viagemease 20msimportantdisplaymozinlinebox importantdisplaymsinlineflexbox importantdisplaywebkitinlineflexsmartcountstr caractere porguestimportantanimationtimingfunctionlinear importantwebkitanimationfillmodebothimportantpaddingright24px importantmediatransparent importantborderradius32pxnmeroimportantfontsize14pxexperincias nicas noacharam estaemailtaxastranslatey50importantclippathinset100 importantheight1px importantoverflowhiddenimportanttransitionboxshadow 02simportantwebkitalignitemsvaracsmtcalignitems flexstart importantalignitemsvaracsmtcalignitemsimportantwebkitboxdirectionnormal importantwebkitboxorientverticalimportanttextalignvaraclgtctextalign0 0 importantminwidth0pximportantborderradius8px12importantmoztransitionnone importanttransitionnonemximo smartcountstrimportantletterspacingvartlletterspacing 0emesteimportantdisplayinlineflexnicas novarhcmdwidth 1 100vwd70466 100contaimportanttextalignvaraclgtctextalign startimportantfontfamilyinherit importantfontsize14pxvarhclgwidth 16importantcolorinherit importantcursorpointertransparent importantcontentfavoritos doimportantwebkitflexdirectioncolumn importantmsflexdirectioncolumnflexstart importanttextalignvaraclgtctextalignvarhclgwidth 16 100vwimportantdisplaywebkitinlineboximportantdisplaywebkitbox importantdisplaymozboximportantbordercolorvarbigsearchformbackgroundpraiaimportantdisplayflex importantwebkitflex1importantalignitemsvaracsmtcalignitems0flexstart importantalignitemsvaracmdtcalignitemsd70466importantalignitemsvaracsmtcalignitems flexstart importanttextalignvaracsmtctextalignimportantpadding0px importantmargin0pxe experinciaster noimportantmoztransition02sffffff importantmedia prefersreducedmotionimportantmstransformorigin50 030pximportantfontweightinherit importantlineheightinheritimportantmstransformorigin50 0 importanttransformorigin50importantboxshadowinset 0px0 importantminwidth0pximportantheight1pximportantlineheightvartllineheight222222 importantmediaendereoimportantdisplaymsflexboxease opacity 50msimportantwidth1pximportantwebkittransitionboxshadow 02s easeacomodaes e experinciasimportantpointereventsnone11fazem acontecer no50msno mundo todoimportantborderradius100 importantdisplayinlineblock importantwebkitanimationnamekeyframe1cjd84a32pximportantcontentimportantfontweightinherit importantfontstyleinherit importantfontvariantinheritffffff 0px 0pximportantleft0px importantpositionabsolute importantright0pxtentenicas no mundoimportantcolor222222 importantcursorpointerporpreo total20ms pointerevents 0mstotal da viagemimportantdisplaywebkitbox importantdisplaymozbox importantdisplaymsflexboxpara oimportantfontweightinherit importantfontstyleinheritimportantdisplayflex importantfontfamilyinherit20msseusimportantwebkitclippathinset100auto importantflex1importantborderradius32px importantbottom0px0px 1pximportantdisplaymozbox importantdisplaymsflexboximportantfontfamilyinheritimportantwebkitanimationduration08s importantanimationduration08sexperincias nicasimportantflex1 1right e61e4dimportanttransitionnonesentence maxflexstart importantmsflexalignvaraclgtcalignitems flexstart01 1100pximportanttextaligninherit importanttextdecorationnoneimportantheight1px importantoverflowhiddenimportantletterspacingvartlletterspacingseguranaestarno mximo smartcountstrimportantborderstylesolid importantbordercolorvarbigsearchformbackground transparentter peloimportantanimationtimingfunctionlinear importantwebkitanimationfillmodeboth importantanimationfillmodebothfazemffffffacontecer noimportantoverflowhidden importantpadding0px importantpositionabsoluteimportantmsflexalignvaracsmtcalignitemse31c5fease importantbordercolor222222para frente paratransparent importantcontent importantdisplaynonevoc estarimportantoutlinenone importantoverflowvisible importantpadding12pxflexstart importantwebkitboxdirectionnormalimportantcontent importantleft0px importantpositionabsoluteimportantwebkitalignitemsvaracmdtcalignitems flexstartfavor tenteimportanttextaligninheritseus itensatualizadopor temporada cabanassentencetransparent importantborderradius32px importantbottom0pximportantmsflexalignvaraclgtcalignitems flexstartimportantright0px importanttop0px importantzindex00651importantdisplaymozinlineboxmximo smartcountstr caracteredeve teranossolidimportantpaddingright24px importantmedia minwidthimportantdisplaywebkitbox02s ease importanttransitionboxshadowcubicbezier0 0anfitries fazem acontecerimportantpositionrelative importanttextaligncenterimportantwebkitanimationtimingfunctionlinear importantanimationtimingfunctionlinear16pxfavorffffff 0pximportantappearancenoneimportantdisplayblockimportantright0px0 importantmedia minwidth01simportantmozappearancenoneease 20ms visibilitylocaisimportantborder1px solidsobrestart importantmedia minwidthimportantfontweightinheritimportantanimationfillmodeboth importantverticalalignmiddlecabanas casasflexstart importantmsflexalignvaracsmtcalignitemsdevectaacomodaoimportantwebkitflexdirectioncolumnimportantpaddingright40px importantmedia02simportantmargin0px importantoutlinenone importantoverflowvisibleimportanttransformorigin50 0importantright0px importanttop5010adequadoimportantdisplaymsinlineflexbox importantdisplaywebkitinlinefleximportantbordercolor222222 importantboxshadow0px 0pximportantwebkituserselectauto importantmozuserselectauto importantmsuserselectautoe31c5f 50importantfontsizevartlfontsizeque vocimportantlineheightinherit importantmargin0px importantoutlinenonetrs1375 translate60pximportantwebkitalignitemsvaracsmtcalignitemsfavoritos50 d70466 100annciofoinaease importantboxshadow0pxe paraimportantwidth0px9significaimportantoverflowhidden importantpadding0pxnoimportantzindex0 importantwebkitflexdirectioncolumn importantmsflexdirectioncolumnimportantpositionabsolute importanttop0pxseu nomeeasetransformimportantwebkitflex1 06adicionaisdicaimportantwhitespacenowrap importantwidth100mnimaopacity cubicbezier035 0acomodaesgarantirimportantmargin1px importantminwidth0pximportantfontfamilyinherit importantfontsizeinheritimportantlineheight20pximportantfontstyleinheritimportantpadding0pximportantborder1px02s ease importantboxshadow0pxfrenteimportantmargin0 autosua102simportantwebkitanimationduration08s importantanimationduration08s importantwebkitanimationiterationcountinfinitemundo todoperfil enossastart importantmediaimportanttransitionboxshadow0 30pxauto importantmsflex1para frentebuttonflexstart importantalignitemsvaracmdtcalignitems flexstart222222 0pxflyoutimportantmsflexalignvaracsmtcalignitems flexstart importantwebkitboxdirectionnormalflexstart importantalignitemsvaracsmtcalignitems flexstartvisibility 0ms 150msimportantflex1 0importantdisplaynone12pximportantalignitemsvaracmdtcalignitems flexstart150msimportantoverflowvisibleimportantminwidth0pxresultadosmaxwidthimportantcursorpointer importantdisplayinlineblockpara trserroflexstart importanttextalignvaracsmtctextalign startpreoflexstart importanttextalignvaracmdtctextalign starttransform0 0 importantflex11 0locaes por temporadaimportantheight6px importantmarginright4px importantborderradius1000 e31c5fright4px ffffffimportantmarginright4px importantborderradius100 importantdisplayinlineblock1pxe61e4dimportantanimationfillmodeboth0 065por temporada2px 222222 importantmediaimportantflex1 0 0praia acomodaes eimportantbottom0px importantcontent importantleft0pximportantwidth338pxaplicadas50ms easeimportantmsuserselectautosmartcountstr caracteres porcasaimportantwebkitlineclampvartllineclampadequado para1 100vwimportantanimationduration08s importantwebkitanimationiterationcountinfinite0 importantmstransformorigin500 01 102simportantzindex1importantdisplaywebkitinlinebox importantdisplaymozinlinebox150ms easetransform 150msimportantmarginbottom0px1px 222222 importantmediaimportantdisplayinlineblock importantwebkitanimationnamekeyframe1cjd84asmartcountstr50 d70466flexstart importantmsflexalignvaracmdtcalignitemsimportantpositionabsolute importantright0px importanttop500 importantwebkitclippathinset100visibility 0mssolugares2px 222222 0px122pximportantwebkitanimationtimingfunctionlinearimportantbordercolorvarbigsearchformbackground transparent importantcontentprefersreducedmotionaluguis por temporadaflexstart importanttextalignvaraclgtctextalign startimportantwebkitappearancenone importantmozappearancenone

Longtail Keyword Density for Airbnb.com.br

KeywordsOccurences
importantdisplay-moz-box importantdisplay-ms-flexbox importantdisplay-webkit-flex29
importantdisplay-ms-flexbox importantdisplay-webkit-flex importantdisplayflex29
importanttransitionbox-shadow 02s ease25
ease importanttransitionbox-shadow 02s25
ease important-moz-transitionbox-shadow 02s25
important-moz-transitionbox-shadow 02s ease25
02s ease importanttransitionbox-shadow24
02s ease important-moz-transitionbox-shadow24
importantdisplay-webkit-box importantdisplay-moz-box importantdisplay-ms-flexbox23
0px 0px 0px22
0px 0px 2px22
0px 0px 4px18
importantbox-shadow0px 0px 0px18
222222 importantmedia prefers-reduced-motion14
ease importantbox-shadow0px 0px14
02s ease importantbox-shadow0px14
por favor tente12
cubic-bezier0 0 0112
0px 2px 22222212
0px 4px 22222210
0 065 19
start importantmedia min-width9
rgba0 0 09
cubic-bezier035 0 0659
acomodaes e experincias9
important-webkit-user-selectauto important-moz-user-selectauto important-ms-user-selectauto8
importanttext-decorationnone important-webkit-user-selectauto important-moz-user-selectauto8
important-moz-user-selectauto important-ms-user-selectauto importantuser-selectauto8
0px 4px ffffff8
222222 0px 0px8
temporada cabanas casas8
por temporada cabanas8
2px 222222 0px8
important-moz-appearancenone importantappearancenone importantbackgroundtransparent8
2px ffffff 0px8
casas de praia8
praia acomodaes e8
ffffff 0px 0px8
0px 2px ffffff8
important-ms-flex1 0 07
important-webkit-align-itemscenter importantalign-itemscenter importantdisplay-webkit-box7
importantalign-itemscenter importantdisplay-webkit-box importantdisplay-moz-box7
0 important-ms-flex1 07
importantflex1 0 07
0 importantflex1 07
0 0 important-ms-flex17
0 0 importantflex17
important-ms-flex-aligncenter important-webkit-align-itemscenter importantalign-itemscenter7
importanttext-aligninherit importanttext-decorationnone important-webkit-user-selectauto6
deve ter no6
importantappearancenone importantbackgroundtransparent importantborder0px6
0 01 102s6
importantmargin0px importantoutlinenone importantoverflowvisible6
opacity 50ms ease6
ter no mximo6
150ms ease opacity6
o preo total6
ver o preo6
0 0 06
para ver o6
importantpadding-right40px importantmedia min-width6
no mximo smartcountstr6
opacity cubic-bezier035 06
4px ffffff importantmedia6
ffffff importantmedia prefers-reduced-motion6
4px 222222 importantmedia6
ease opacity 50ms6
50ms ease 20ms6
0 01 16
transform cubic-bezier0 06
locaes por temporada5
important-webkit-flex-directioncolumn important-ms-flex-directioncolumn importantflex-directioncolumn5
important-webkit-flex1 0 05
important-webkit-transitionbox-shadow 02s ease5
e experincias nicas5
important-webkit-appearancenone important-moz-appearancenone importantappearancenone5
configuraes de conta5
importantborder1px solid transparent5
importantbox-shadowinset 0px 0px4
ease importantborder-color222222 importantbox-shadow0px4
experincias nicas no4
0px 0px 1px4
02s ease importantborder-color2222224
02s ease importantbox-shadowinset4
solid transparent importantborder-radius32px4
importantbottom0px importantcontent importantleft0px4
2px 222222 importantmedia4
importantcontent importantleft0px importantpositionabsolute4
importantleft0px importantpositionabsolute importantright0px4
1px 222222 importantmedia4
ease importantbox-shadowinset 0px4
0px 1px 2222224
importantborder-color222222 importantbox-shadow0px 0px4
importantpositionabsolute importantright0px importanttop0px4
senha deve ter4
nicas no mundo4
importantfont-sizeinherit importantfont-weightinherit importantline-heightinherit4
importantdisplay-moz-inline-box importantdisplay-ms-inline-flexbox importantdisplay-webkit-inline-flex4
102s transform cubic-bezier04
importantdisplay-ms-inline-flexbox importantdisplay-webkit-inline-flex importantdisplayinline-flex4
150ms easetransform 150ms4
easetransform 150ms ease4
important-ms-flex-aligncenter important-webkit-appearancenone important-moz-appearancenone4
importantpadding-right80px importantmedia min-width4
importantfont-familyinherit importantfont-sizeinherit importantfont-weightinherit4
datas para ver4
importantpadding-right24px importantmedia min-width4
todo anfitries fazem4
01 102s transform4
aluguis por temporada4
fazem acontecer no4
-webkit-transform cubic-bezier0 04
no mundo todo4
anfitries fazem acontecer4
mundo todo anfitries4
adicionais sero aplicadas3
importantdisplayinline-block important-webkit-animation-namekeyframe1cjd84a importantanimation-namekeyframe1cjd84a3
importantborder-radius100 importantdisplayinline-block important-webkit-animation-namekeyframe1cjd84a3
importantmargin-right4px importantborder-radius100 importantdisplayinline-block3
importantheight6px importantmargin-right4px importantborder-radius1003
importantwidth6px importantheight6px importantmargin-right4px3
flex-start importantalign-itemsvar--ac-md-tc-align-items flex-start3
importantletter-spacingvar--tl-letter-spacing 0em importantline-heightvar--tl-line-height3
importantalign-itemsvar--ac-md-tc-align-items flex-start importanttext-alignvar--ac-md-tc-text-align3
flex-start importanttext-alignvar--ac-lg-tc-text-align start3
importantalign-itemsvar--ac-lg-tc-align-items flex-start importanttext-alignvar--ac-lg-tc-text-align3
flex-start importantalign-itemsvar--ac-lg-tc-align-items flex-start3
important-webkit-align-itemsvar--ac-lg-tc-align-items flex-start importantalign-itemsvar--ac-lg-tc-align-items3
importantwidth383px important-webkit-align-itemsvar--ac-lg-tc-align-items flex-start3
flex-start important-ms-flex-alignvar--ac-lg-tc-align-items flex-start3
importanttext-alignvar--ac-md-tc-text-align start importantmedia3
flex-start importanttext-alignvar--ac-md-tc-text-align start3
important-webkit-align-itemsvar--ac-md-tc-align-items flex-start importantalign-itemsvar--ac-md-tc-align-items3
importanttext-alignvar--ac-lg-tc-text-align start importantmedia3
important-webkit-animation-timing-functionlinear importantanimation-timing-functionlinear important-webkit-animation-fill-modeboth3
sentence max 203
important-webkit-animation-fill-modeboth importantanimation-fill-modeboth importantvertical-alignmiddle3
ter pelo menos3
smartcountstr caractere por3
caractere por favor3
que voc est3
danaturezasugestes de favoritos3
para frente para3
importantfont-weightinherit importantfont-styleinherit importantfont-variantinherit3
smartcountstr caracteres por3
caracteres por favor3
mximo smartcountstr caractere3
important-webkit-animation-namekeyframe1cjd84a importantanimation-namekeyframe1cjd84a important-webkit-animation-duration08s3
mximo smartcountstr caracteres3
senha no pode3
nmero de telefone3
importantanimation-timing-functionlinear important-webkit-animation-fill-modeboth importantanimation-fill-modeboth3
acharam esta dica3
importantanimation-iteration-countinfinite important-webkit-animation-timing-functionlinear importantanimation-timing-functionlinear3
important-webkit-animation-iteration-countinfinite importantanimation-iteration-countinfinite important-webkit-animation-timing-functionlinear3
importantanimation-duration08s important-webkit-animation-iteration-countinfinite importantanimation-iteration-countinfinite3
important-webkit-animation-duration08s importantanimation-duration08s important-webkit-animation-iteration-countinfinite3
importantanimation-namekeyframe1cjd84a important-webkit-animation-duration08s importantanimation-duration08s3
importantwidth338px important-webkit-align-itemsvar--ac-md-tc-align-items flex-start3
importantfont-weightinherit importantline-heightinherit importantmargin0px3
flex-start important-ms-flex-alignvar--ac-md-tc-align-items flex-start3
importantheight1px importantoverflowhidden importantpadding0px3
importantdisplay-webkit-flex importantdisplayflex important-webkit-flex13
importantcliprect0 0 03
0 0 important-webkit-clip-pathinset1003
0 important-webkit-clip-pathinset100 importantclip-pathinset1003
important-webkit-clip-pathinset100 importantclip-pathinset100 importantheight1px3
importantclip-pathinset100 importantheight1px importantoverflowhidden3
importantoverflowhidden importantpadding0px importantpositionabsolute3
importantpadding0px importanttext-aligninherit importanttext-decorationnone3
importantpadding0px importantpositionabsolute importantwhite-spacenowrap3
importantpositionabsolute importantwhite-spacenowrap importantwidth1px3
ease transform 01s3
transform 01s ease3
transparent importantborder-radius32px importantbottom0px3
importantborder-radius32px importantbottom0px importantcontent3
0 0 importantmin-width0px3
importantdisplay-webkit-flex importantdisplayflex importantfont-familyinherit3
1px importantborder-stylesolid importantborder-colorvar--big-search-form-background3
1375 translate-60px 122px3
bottom 000 rgba03
000 rgba0 03
0 important-ms-transform-origin50 03
important-ms-transform-origin50 0 importanttransform-origin503
0 importanttransform-origin50 03
importantdisplay-webkit-inline-box importantdisplay-moz-inline-box importantdisplay-ms-inline-flexbox3
ease 20ms visibility3
importantcursorpointer importantdisplay-webkit-box importantdisplay-moz-box3
20ms visibility 0ms3
visibility 0ms 150ms3
ease 20ms pointer-events3
20ms pointer-events 0ms3
pointer-events 0ms 150ms3
0 importantmedia min-width3
importantright0px importanttop0px importantz-index03
importantborder-stylesolid importantborder-colorvar--big-search-form-background transparent3
importanttext-alignvar--ac-sm-tc-text-align start importantmedia3
importantz-index0 important-webkit-flex-directioncolumn important-ms-flex-directioncolumn3
9 var--hc-lg-width 163
var--hc-lg-width 16 100vw3
flex-start important-ms-flex-alignvar--ac-sm-tc-align-items flex-start3
important-ms-flex-alignvar--ac-sm-tc-align-items flex-start important-webkit-box-directionnormal3
flex-start important-webkit-box-directionnormal important-webkit-box-orientvertical3
important-webkit-box-orientvertical importantdisplay-webkit-box importantdisplay-moz-box3
important-ms-flex-directioncolumn importantflex-directioncolumn importantwidth280px3
1 var--hc-md-width 13
importantflex-directioncolumn importantwidth280px important-webkit-align-itemsvar--ac-sm-tc-align-items3
importantwidth280px important-webkit-align-itemsvar--ac-sm-tc-align-items flex-start3
important-webkit-align-itemsvar--ac-sm-tc-align-items flex-start importantalign-itemsvar--ac-sm-tc-align-items3
flex-start importantalign-itemsvar--ac-sm-tc-align-items flex-start3
importantalign-itemsvar--ac-sm-tc-align-items flex-start importanttext-alignvar--ac-sm-tc-text-align3
flex-start importanttext-alignvar--ac-sm-tc-text-align start3
var--hc-md-width 1 100vw3
var--hc-sm-width 3 100vw3
importantborder-colorvar--big-search-form-background transparent importantcontent3
max-width cubic-bezier035 03
transparent importantcontent importantdisplaynone3
importantcontent importantdisplaynone importantheight32px3
importantmargin-top-16px importantpositionabsolute importantright0px3
importantpositionabsolute importantright0px importanttop503
importantright0px importanttop50 importantz-index03
importantline-heightinherit importantmargin0px importantoutlinenone3
right e61e4d 03
4 var--hc-sm-width 33
e61e4d 0 e31c5f3
0 e31c5f 503
e31c5f 50 d704663
50 d70466 1003
importantline-height18px importantmargin0px importantoutlinenone3
importantoutlinenone importantoverflowvisible importantpadding12px3
total da viagem3
02s ease75
importantmedia min-width73
0px 0px66
0 046
importantmedia prefers-reduced-motion34
important-moz-transitionnone importanttransitionnone34
importantdisplay-moz-box importantdisplay-ms-flexbox29
importantdisplay-ms-flexbox importantdisplay-webkit-flex29
importantdisplay-webkit-flex importantdisplayflex29
important-moz-transitionbox-shadow 02s25
importanttransitionbox-shadow 02s25
ease important-moz-transitionbox-shadow25
ease importanttransitionbox-shadow25
importantdisplay-webkit-box importantdisplay-moz-box23
0px 2px22
0px 4px19
importantbox-shadow0px 0px18
important-webkit-align-itemscenter importantalign-itemscenter15
0 auto15
importantpadding0px importantmargin0px15
222222 importantmedia14
ease importantbox-shadow0px14
0 0112
favor tente12
por favor12
cubic-bezier0 012
2px 22222212
importantflex1 011
important-ms-flex1 011
1 auto10
4px 22222210
e experincias10
0 0659
start importantmedia9
rgba0 09
0 importantflex19
0 important-ms-flex19
deve ter9
por temporada9
important-moz-appearancenone importantappearancenone9
065 19
acomodaes e9
cubic-bezier035 09
cabanas casas8
222222 0px8
importanttext-decorationnone important-webkit-user-selectauto8
important-webkit-user-selectauto important-moz-user-selectauto8
important-moz-user-selectauto important-ms-user-selectauto8
important-ms-user-selectauto importantuser-selectauto8
4px ffffff8
para ver8
importantappearancenone importantbackgroundtransparent8
praia acomodaes8
ffffff 0px8
temporada cabanas8
2px ffffff8
important-ms-flex-aligncenter important-webkit-align-itemscenter7
importantbottom0px importantcontent7
importantpositionabsolute importantright0px7
importanttext-aligninherit importanttext-decorationnone7
importantoutlinenone importantoverflowvisible7
importantalign-itemscenter importantdisplay-webkit-box7
solid dddddd7
importantborder1px solid7
para o7
importantmargin0px importantoutlinenone7
ffffff importantmedia7
ter no6
01 102s6
onde voc6
0 140px6
ver o6
1 06
01s ease6
o preo6
importantleft0px importantpositionabsolute6
transform cubic-bezier06
preo total6
01 16
no mximo6
mximo smartcountstr6
importantbackgroundtransparent importantborder0px6
importantpadding-right40px importantmedia6
150ms ease6
ease opacity6
opacity 50ms6
50ms ease6
ease 20ms6
0ms 150ms6
opacity cubic-bezier0356
important-webkit-flex1 05
importantmargin0px importantpadding0px5
seta para5
important-webkit-flex-directioncolumn important-ms-flex-directioncolumn5
esta dica5
0px 1px5
important-ms-flex-directioncolumn importantflex-directioncolumn5
importantpositionrelative importantz-index15
podem ser5
em sua5
para frente5
importantflex0 05
important-ms-flex0 05
locaes por5
importantfont-familyinherit importantfont-sizeinherit5
experincias nicas5
important-webkit-appearancenone important-moz-appearancenone5
important-webkit-transitionbox-shadow 02s5
solid transparent5
importantpadding-right80px importantmedia5
importantborder-color222222 importantbox-shadow0px4
1 important-moz-transition02s4
no mundo4
mundo todo4
nicas no4
102s transform4
ease importantbox-shadowinset4
1 importanttransition02s4
transparent importantborder-radius32px4
todo anfitries4
h smartcountstr4
importantright0px importanttop0px4
aluguis por4
que voc4
importantcontent importantleft0px4
anfitries fazem4
fazem acontecer4
1px 2222224
melhor da4
acontecer no4
importanttop0px importantz-index04
ease importantborder-color2222224
smartcountstr caractere4
-webkit-transform cubic-bezier04
pelo menos4
taxas adicionais4
datas para4
importantpadding-right24px importantmedia4
auto important-ms-flex04
auto importantflex04
importantfont-size14px importantline-height18px4
importantdisplay-moz-inline-box importantdisplay-ms-inline-flexbox4
importantdisplay-ms-inline-flexbox importantdisplay-webkit-inline-flex4
importantdisplay-webkit-inline-flex importantdisplayinline-flex4
150ms easetransform4
importantfont-weight400 importantpadding10px4
senha no4
smartcountstr caracteres4
important-ms-flex-aligncenter important-webkit-appearancenone4
easetransform 150ms4
importantbox-shadowinset 0px4
important-ms-flex1 14
importantfont-sizeinherit importantfont-weightinherit4
o airbnb4
seu nome4
importantoverflowhidden importantpadding0px4
importantcursorpointer importantdisplayinline-block4
senha deve4
importantfont-weightinherit importantline-heightinherit4
importantfont-styleinherit importantfont-variantinherit3
importantfont-weightinherit importantfont-styleinherit3
importanttext-alignvar--ac-lg-tc-text-align start3
flex-start importantalign-itemsvar--ac-lg-tc-align-items3
importantalign-itemsvar--ac-lg-tc-align-items flex-start3
important-webkit-align-itemsvar--ac-lg-tc-align-items flex-start3
flex-start importanttext-alignvar--ac-lg-tc-text-align3
importantanimation-fill-modeboth importantvertical-alignmiddle3
important-webkit-animation-fill-modeboth importantanimation-fill-modeboth3
importantanimation-timing-functionlinear important-webkit-animation-fill-modeboth3
important-webkit-animation-iteration-countinfinite importantanimation-iteration-countinfinite3
importantdisplayinline-block important-webkit-animation-namekeyframe1cjd84a3
importantmax-width100 importantfont-sizevar--tl-font-size3
importantanimation-duration08s important-webkit-animation-iteration-countinfinite3
important-webkit-animation-timing-functionlinear importantanimation-timing-functionlinear3
importantletter-spacingvar--tl-letter-spacing 0em3
important-webkit-animation-duration08s importantanimation-duration08s3
importantanimation-namekeyframe1cjd84a important-webkit-animation-duration08s3
0em importantline-heightvar--tl-line-height3
importantwidth6px importantheight6px3
important-webkit-animation-namekeyframe1cjd84a importantanimation-namekeyframe1cjd84a3
importantheight6px importantmargin-right4px3
importantmargin-right4px importantborder-radius1003
importantborder-radius100 importantdisplayinline-block3
importantanimation-iteration-countinfinite important-webkit-animation-timing-functionlinear3
perfil e3
frente para3
ter pelo3
total da3
sero aplicadas3
adicionais sero3
para estadias3
partir defromend3
max 203
sentence max3
acharam esta3
adequado para3
lugares para3
no pode3
caracteres por3
caractere por3
important-ms-flex-alignvar--ac-lg-tc-align-items flex-start3
para acessar3
significa que3
seus itens3
airbnb luxe3
um erro3
e para3
para trs3
sua viagem3
da sua3
anos ou3
voc estar3
voc est3
favoritos do3
melhor danaturezasugestes3
importantwidth383px important-webkit-align-itemsvar--ac-lg-tc-align-items3
importantline-heightinherit importantmargin0px3
flex-start important-ms-flex-alignvar--ac-lg-tc-align-items3
importantclip-pathinset100 importantheight1px3
importantcursorpointer importantdisplay-webkit-box3
importantdisplayflex importantfont-familyinherit3
importantpadding0px importanttext-aligninherit3
importantmin-width0px importantpositionrelative3
importantflex1 13
0 importantmin-width0px3
importantdisplayflex important-webkit-flex13
importantcliprect0 03
0 important-webkit-clip-pathinset1003
important-webkit-clip-pathinset100 importantclip-pathinset1003
importantheight1px importantoverflowhidden3
0 323
importantpadding0px importantpositionabsolute3
importantpositionabsolute importantwhite-spacenowrap3
importantwhite-spacenowrap importantwidth1px3
importantpositionrelative importanttext-aligncenter3
importantline-height18px importantfont-weight6003
ease transform3
transform 01s3
importantmargin-1px importantmin-width0px3
importantborder-radius32px importantbottom0px3
1px importantborder-stylesolid3
importantcolorinherit importantcursorpointer3
important-webkit-flex0 03
importantborder-colorvar--big-search-form-background transparent3
importantwidth100 importantz-index13
bottom 0003
000 rgba03
importantpositionabsolute importanttop0px3
importanttop0px importantwidth1003
opacity ease3
0 important-ms-transform-origin503
important-ms-transform-origin50 03
0 importanttransform-origin503
importanttransform-origin50 03
importantpositionrelative importantwidth1003
importantmargin0 auto3
0 importantmedia3
auto important-ms-flex13
auto importantflex13
importantdisplay-webkit-inline-box importantdisplay-moz-inline-box3
1375 translate-60px3
translate-60px 122px3
20ms visibility3
visibility 0ms3
1375 translatey58px3
20ms pointer-events3
pointer-events 0ms3
importantborder-stylesolid importantborder-colorvar--big-search-form-background3
transparent importantcontent3
importanttext-alignvar--ac-md-tc-text-align start3
important-webkit-align-itemsvar--ac-sm-tc-align-items flex-start3
var--hc-lg-width 163
16 100vw3
flex-start important-ms-flex-alignvar--ac-sm-tc-align-items3
important-ms-flex-alignvar--ac-sm-tc-align-items flex-start3
flex-start important-webkit-box-directionnormal3
important-webkit-box-directionnormal important-webkit-box-orientvertical3
important-webkit-box-orientvertical importantdisplay-webkit-box3
importantz-index0 important-webkit-flex-directioncolumn3
importantflex-directioncolumn importantwidth280px3
importantwidth280px important-webkit-align-itemsvar--ac-sm-tc-align-items3
flex-start importantalign-itemsvar--ac-sm-tc-align-items3
1 100vw3
importantalign-itemsvar--ac-sm-tc-align-items flex-start3
flex-start importanttext-alignvar--ac-sm-tc-text-align3
importanttext-alignvar--ac-sm-tc-text-align start3
flex-start important-ms-flex-alignvar--ac-md-tc-align-items3
important-ms-flex-alignvar--ac-md-tc-align-items flex-start3
importantwidth338px important-webkit-align-itemsvar--ac-md-tc-align-items3
important-webkit-align-itemsvar--ac-md-tc-align-items flex-start3
flex-start importantalign-itemsvar--ac-md-tc-align-items3
importantalign-itemsvar--ac-md-tc-align-items flex-start3
flex-start importanttext-alignvar--ac-md-tc-text-align3
9 var--hc-lg-width3
var--hc-md-width 13
importantcontent importantdisplaynone3
0 e31c5f3
importantdisplaynone importantheight32px3
importantmargin-top-16px importantpositionabsolute3
importantright0px importanttop503
importanttop50 importantz-index03
0 0px3
do airbnb3
importantwhite-spacenowrap importantwidth1003
max-width cubic-bezier0353
right e61e4d3
e61e4d 03
e31c5f 503
1 var--hc-md-width3
50 d704663
d70466 1003
importantfont-familyinherit importantfont-size14px3
importantline-height18px importantmargin0px3
importantoverflowvisible importantpadding12px3
importantcolor222222 importantcursorpointer3
0 30px3
4 var--hc-sm-width3
var--hc-sm-width 33
3 100vw3
da viagem3
0165
0px115
importantmedia109
ease96
02s75
min-width73
para69
smartcountstr61
e54
flex-start52
no43
o41
137
prefers-reduced-motion34
importanttransitionnone34
por34
important-moz-transitionnone34
do30
auto29
229
importantdisplayflex29
importantdisplay-webkit-flex29
importantdisplay-ms-flexbox29
importantdisplay-moz-box29
importantmargin0px28
sua27
2px27
importantpositionrelative26
uma26
important-moz-transitionbox-shadow25
importanttransitionbox-shadow25
da25
importantpadding0px25
em24
importantdisplay-webkit-box23
importantbox-shadow0px21
4px21
um21
importantpositionabsolute21
voc20
ffffff20
importanttext-decorationnone19
ou19
tente18
150ms18
que17
importantcolor22222217
airbnb17
importantwidth10017
opacity16
mais16
solid16
importantz-index016
importantline-height18px15
importantcontent15
importantalign-itemscenter15
important-ms-flex115
importantz-index115
important-ms-flex-aligncenter15
important-webkit-align-itemscenter15
importantflex114
importantleft0px13
acomodaes13
transform12
favor12
conta12
0112
cubic-bezier012
total12
center12
experincias11
seu11
ter11
importantfont-familyinherit11
importantwhite-spacenowrap11
1px10
importantmin-width0px10
importantoverflowhidden10
importantright0px10
senha10
importantoutlinenone10
importantdisplayinline-block10
ser10
importantcursorpointer10
datas10
importantbackgroundtransparent10
importanttop0px9
0659
casas9
rgba09
important-moz-appearancenone9
cubic-bezier0359
maxtotalresults9
os9
deve9
100vw9
est9
importantappearancenone9
16px9
temporada9
start9
importantpadding-right24px9
important-webkit-user-selectauto8
important-moz-user-selectauto8
important-ms-user-selectauto8
cabanas8
importantuser-selectauto8
importantborder0px8
importantbottom0px8
importantdisplaynone8
data8
ver8
este8
nmero8
praia8
importantfont-weight4008
importantfont-weightinherit8
importantfont-weight6008
preo8
-webkit-transform8
importantheight1008
importantpadding-right80px8
importantfont-size14px8
importantcolorinherit8
importantvertical-alignmiddle8
transparent8
importantoverflowvisible7
configuraes7
important-webkit-flex17
caracteres7
mximo7
importanttext-aligncenter7
melhor7
dos7
importantflex07
important-ms-flex07
importanttext-aligninherit7
pode7
dddddd7
taxas7
importantborder1px7
adicionais6
partir6
36
importanttext-alignleft6
50ms6
20ms6
importantline-heightinherit6
seus6
46
como6
0ms6
viagem6
guest6
favoritos6
esta6
importantpadding-right40px6
onde6
102s6
anfitries6
fazem6
01s6
nome6
140px6
podem5
importantfont-sizeinherit5
12px5
locaes5
important-webkit-box-orientvertical5
important-webkit-flex-directioncolumn5
important-ms-flex-directioncolumn5
importantflex-directioncolumn5
na5
locais5
frente5
seta5
important-webkit-appearancenone5
estadia5
nicas5
so5
host5
h5
important-webkit-transitionbox-shadow5
text5
mundo5
max5
pelo5
importanttop505
menos5
importantborder-stylesolid5
importantpadding10px5
importantheight32px5
importantborder-radius32px5
dica5
importantmargin-1px4
ms4
cta4
importantborder-color2222224
sobre4
resposta4
suggestion4
importantline-height16px4
resultados4
modal4
sem4
important-webkit-flex04
importantdisplayblock4
importanttransition02s4
label4
acontecer4
important-moz-transition02s4
ao4
importanttext-decorationunderline4
important-webkit-transition02s4
importantopacity04
-ms-transform4
todo4
importantline-height20px4
aplicadas4
importantheight1px4
anos4
aluguis4
40px4
importantmax-width1004
importantbox-shadowinset4
easetransform4
importantdisplay-moz-inline-box4
email4
importantdisplayinline-flex4
lugares4
sero4
importantdisplay-ms-inline-flexbox4
importantdisplay-webkit-inline-flex4
suas4
caractere4
54
right4
page4
telefone3
pessoas3
dinheiro3
qualquer3
63
itens3
significa3
acharam3
smartcount3
title3
casa3
segurana3
anncio3
impostos3
perfil3
acomodao3
viagens3
garantir3
bebs3
noite3
mnima3
dia3
mas3
landing3
trs3
foi3
bar3
sentence3
crianas3
todas3
defromend3
button3
adequado3
flyout3
erro3
atrssmartcountstr3
estadias3
luxe3
copy3
atualizado3
important-ms-flex-alignvar--ac-sm-tc-align-items3
ponto3
d704663
importantborder-radius8px3
32px3
6px3
importantborder-colorvar--big-search-form-background3
importantmargin-top-16px3
importantwidth0px3
max-width3
e61e4d3
e31c5f3
importantpadding12px3
importantwidth1px3
30px3
100px3
73
var--hc-sm-width3
83
var--hc-md-width3
importantsupports3
min85vh3
93
importantleft503
importantclip-pathinset1003
103
importantheight80px3
algumas3
bottom3
0003
importantpointer-eventsnone3
important-ms-transform-origin503
importanttransform-origin503
importantmargin03
24px3
importantdisplay-webkit-inline-box3
translate-60px3
important-webkit-clip-pathinset1003
122px3
visibility3
translatey58px3
pointer-events3
113
importantbackground-colorffffff3
importanttext-overflowellipsis3
importantpointer-eventsauto3
importantcliprect03
var--hc-lg-width3
important-webkit-box-directionnormal3
endereo3
importantanimation-timing-functionlinear3
importantmargin-right4px3
importantborder-radius1003
important-webkit-animation-namekeyframe1cjd84a3
importantanimation-namekeyframe1cjd84a3
important-webkit-animation-duration08s3
importantanimation-duration08s3
important-webkit-animation-iteration-countinfinite3
importantanimation-iteration-countinfinite3
important-webkit-animation-timing-functionlinear3
important-webkit-animation-fill-modeboth3
importantwidth6px3
importantanimation-fill-modeboth3
importantfont-styleinherit3
importantfont-variantinherit3
nossa3
acessar3
danaturezasugestes3
moradores3
estar3
123
importantheight6px3
translatey-503
importantwidth280px3
importantwidth383px3
important-webkit-align-itemsvar--ac-sm-tc-align-items3
importantalign-itemsvar--ac-sm-tc-align-items3
importanttext-alignvar--ac-sm-tc-text-align3
important-ms-flex-alignvar--ac-md-tc-align-items3
importantwidth338px3
important-webkit-align-itemsvar--ac-md-tc-align-items3
importantalign-itemsvar--ac-md-tc-align-items3
importanttext-alignvar--ac-md-tc-text-align3
important-ms-flex-alignvar--ac-lg-tc-align-items3
important-webkit-align-itemsvar--ac-lg-tc-align-items3
importantmargin-bottom0px3
importantalign-itemsvar--ac-lg-tc-align-items3
importanttext-alignvar--ac-lg-tc-text-align3
importantfont-sizevar--tl-font-size3
importantfont-weightvar--tl-font-weight3
importantletter-spacingvar--tl-letter-spacing3
0em3
importantline-heightvar--tl-line-height3
importantcolorvar--tl-color3
important-webkit-line-clampvar--tl-line-clamp3
8px3
taxa3

Who hosts Airbnb.com.br?

Airbnb.com.br Hosting Provider Information

Hosted IP Address:3.215.205.65
Hosted Hostname:ec2-3-215-205-65.compute-1.amazonaws.com
Service Provider:AMAZON-AES
Hosted Country:United StatesUS
Location Latitude:39.0481
Location Longitude:-77.4728
Webserver Software:nginx

Is "AMAZON-AES" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%

HTTP Header Analysis for Airbnb.com.br

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Content-Type: text/html;charset=utf-8
x-instrumentation: airbnb
x-server-lifecycle-phase: running
status: 200 OK
x-kraken-loop-name: core-guest-loop
accept-ch-lifetime: 31536000
Content-Security-Policy: child-src blob:; connect-src 'self' https: wss://ws.airbnb.com https://netverify.com https://*.netverify.com wss: *.amap.com https://*.mapbox.com; default-src 'self' https: blob:; font-src 'self' data: https://*.muscache.com fonts.gstatic.com https://use.typekit.net; frame-src * https://*.cardinalcommerce.com; img-src 'self' https: data: https://*.mapbox.com blob:; media-src 'self' https: blob:; script-src 'nonce-59cc886eb4eda203876bb567d166c1a2' 'self' 'unsafe-eval' https://a0.muscache.com https://cdn.siftscience.com https://ss.musthird.com https://t1.musthird.com https://bat.bing.com https://connect.facebook.net https://www.google-analytics.com https://www.googleadservices.com https://tpc.googlesyndication.com https://www.googletagmanager.com https://a.cdn.intentmedia.net https://maps.googleapis.com https://ajax.googleapis.com https://*.g.doubleclick.net https://www.google.com https://www.gstatic.com https://smartlock.google.com https://accounts.google.com https://app.link https://cdn.branch.io https://api.branch.io https://bam.nr-data.net https://js-agent.newrelic.com https://sslwidget.criteo.com https://static.criteo.net https://dis.criteo.com https://widget.us.criteo.com https://*.gbc.criteo.net https://ethn.io https://s.yimg.jp https://api.geetest.com https://cdn.ampproject.org https://storage.googleapis.com/workbox-cdn/ https://tagmanager.google.com https://pay.google.com https://songbird.cardinalcommerce.com/ https://www.recaptcha.net https://www.gstatic.cn https://client-api.arkoselabs.com 'sha256-rAm9O8JPZLtQmd84zMDzhsG5q35JscESxxcaFL7 DDc=' 'sha256-ck0NYnSq6evDrSU3QAgDAso6GSMHXE8SDlqTKWnxpKI=' 'sha256-unNS2hE8JL3DiCvbgciUWKx2e8vTc1xSu2HjW59Esgk=' 'sha256- DMqUACVS8B0N29g0M3MeqqvH2pF88VHSCl59PH Z0Q=' 'sha256-ZYbvQDm /uEZNXc DKgP4M43y5ry9kGSdIPWCxAPuQ8=' 'sha256-3ss3Pdz060SMHESdgB6b/4MCtQw6UChP6t 0NloA4gQ=' https://netverify.com https://*.netverify.com https://icm.aexp-static.com https://qicm.americanexpress.com https://qwww435.americanexpress.com https://checkout.americanexpress.com https://www.paypalobjects.com https://c.paypal.com https://www.paypal.com blob: https://vdata.amap.com https://webapi.amap.com https://restapi.amap.com https://*.mapbox.com https://songbird.cardinalcommerce.com https://songbirdstag.cardinalcommerce.com https://includes.ccdc02.com https://includestest.ccdc02.com; style-src 'self' https: 'unsafe-inline' https://*.mapbox.com; worker-src 'self'; report-uri /tracking/csp?controller=core-guest-loop&action=/&req_uuid=0d92f371-dbee-4d26-9d4a-b49fb97820f4&version=sha=6b0dca6c9aa&report_only=false; report-to /tracking/csp?controller=core-guest-loop&action=/&req_uuid=0d92f371-dbee-4d26-9d4a-b49fb97820f4&version=sha=6b0dca6c9aa&report_only=false
x-ua-compatible: IE=Edge,chrome=1
x-frame-options: SAMEORIGIN
x-envoy-upstream-service-time: 771
x-xss-protection: 1; mode=block
Accept-CH: Device-Memory, DPR, ECT, Viewport-Width
x-content-type-options: nosniff
Link:;rel=preload;as=style,;rel=preload;as=font;type=font/woff2;crossorigin=crossorigin,;rel=preload;as=font;type=font/woff2;crossorigin=crossorigin,;rel=preload;as=font;type=font/woff2;crossorigin=crossorigin
Content-Encoding: gzip
Strict-Transport-Security: max-age=10886400; includeSubdomains
X-Akamai-Transformed: 9 80154 0 pmb=mTOE,1
Cache-Control: public, max-age=8378
Date: Sun, 16 May 2021 04:05:59 GMT
Transfer-Encoding: chunked
Connection: Transfer-Encoding
Vary: Accept-Encoding
Server-Timing: cdn-cache; desc=MISS, edge; dur=24, origin; dur=UNSET
X-PDP-UNCACHING-HASH: 0
x-browser-type: unknown
x-erf-bev-bev-is-generated: 1
x-erf-bev-bev: 1621137959_ZDkyY2FmN2JlOTk5

Airbnb.com.br Domain Nameserver Information

HostIP AddressCountry
dns4.p01.nsone.net 198.51.45.65
dns3.p01.nsone.net 198.51.44.65
dns2.p01.nsone.net 198.51.45.1
dns1.p01.nsone.net 198.51.44.1


Need to find out who hosts Airbnb.com.br?


Domain Registration (WhoIs) information for Airbnb.com.br

 % Copyright (c) Nic.br
% The use of the data below is only permitted as described in
% full by the terms of use at https://registro.br/termo/en.html ,
% being prohibited its distribution, commercialization or
% reproduction, in particular, to use it for advertising or
% any similar purpose.
% 2021-05-16T01:06:02-03:00 - IP: 3.8.139.228

domain: airbnb.com.br
owner: Airbnb Brasil Serv. e Cadastro de Hospedagem Ltda.
ownerid: 14.546.674/0001-09
responsible: Airbnb Brasil Serv. e Cadastro de Hosped
country: BR
owner-c: ABSCL7
tech-c: NAB51
nserver: dns4.p01.nsone.net
nsstat: 20210515 AA
nslastaa: 20210515
nserver: dns3.p01.nsone.net
nsstat: 20210515 AA
nslastaa: 20210515
nserver: dns2.p01.nsone.net
nsstat: 20210515 AA
nslastaa: 20210515
nserver: dns1.p01.nsone.net
nsstat: 20210515 AA
nslastaa: 20210515
nserver: ns2.p74.dynect.net
nsstat: 20210515 NOT SYNC ZONE
nslastaa: 20210515
nserver: ns1.p74.dynect.net
nsstat: 20210515 NOT SYNC ZONE
nslastaa: 20210515
created: 20100617 #6995423
changed: 20190531
expires: 20210617
status: published

nic-hdl-br: ABSCL7
person: Airbnb Brasil Serv. e Cad. de Hosp. Ltda
e-mail: Login to show email
BR
created: 20150421
changed: 20150421

nic-hdl-br: NAB51
person: NameAction do Brasil
e-mail: Login to show email
BR
created: 20020619
changed: 20181011

% Security and mail abuse issues should also be addressed to
% cert.br, http://www.cert.br/ , respectivelly to Login to show email
and Login to show email
whois.registro.br accepts only direct match queries. Types
% of queries are: domain (.br), registrant (tax ID), ticket,
% provider, CIDR block, IP and ASN.

Websites with Similar Names

Airbnb---1.com
Welcome to your new website
Airbnb-1.com
Welcome to your new website
Airbnb-3d.com
Error 404 (Not Found)!!1
Airbnb-ab.com
欧洲杯有什么开户app|官网首页
Airbnb-ad.link
Index of /
Airbnb-anfitriao.com
Anfitrião Airbnb – Ganhe muito dinheiro e se torne um Superhost

Recently Updated Websites

Vetswithcoins.net (2 seconds ago.)Agelesswisdom.life (4 seconds ago.)Tianbo250.app (4 seconds ago.)Sharelawvideo.org (4 seconds ago.)Floorheater.repair (5 seconds ago.)Safety4you2020.cyou (6 seconds ago.)Moto-velo.com.ua (6 seconds ago.)Lifeholy.com (7 seconds ago.)Formaselectricas.store (7 seconds ago.)Sheepandwoolinternational.org (8 seconds ago.)Snakeriveronions.com (8 seconds ago.)Greatback.com (8 seconds ago.)Campingcomanges.com (9 seconds ago.)Horsecountrytradeco.com (9 seconds ago.)Missperfectlovesfilm.com (9 seconds ago.)Ultilike.com (10 seconds ago.)Juliebixbymn.com (10 seconds ago.)Dogproject.com (10 seconds ago.)Yabovip674.vip (11 seconds ago.)Benoitdereau.com (11 seconds ago.)Fabiosalcedo.com (12 seconds ago.)Theblossombox.org (12 seconds ago.)Cleascore.credit (12 seconds ago.)Jogoduga.art (12 seconds ago.)Playmorednd.com (13 seconds ago.)Bfbmemberships.com (13 seconds ago.)Armusik.ru (14 seconds ago.)Kadingcat.com (14 seconds ago.)Virtualtraveling.org (14 seconds ago.)Diamondstone.ir (14 seconds ago.)

Recently Searched Keywords

інтимні товари (2 seconds ago.)crocus (3 seconds ago.)i. e. (3 seconds ago.)letter of recommendation (3 seconds ago.)chef lezioni di (4 seconds ago.)pgi5f7f21f60fe383001790227b2 (5 seconds ago.)full cast (5 seconds ago.)brand management company details (6 seconds ago.)t s r (7 seconds ago.)секреты работы с госзакупками и контрактного кредитования (8 seconds ago.)瑞典主推群体免疫专家后悔了 (8 seconds ago.)never expires (13 seconds ago.)2500 4000 over (13 seconds ago.)crom vanadium (13 seconds ago.)секреты работы с госзакупками и контрактного кредитования (15 seconds ago.)banyonuzda (16 seconds ago.)free4pc (17 seconds ago.)rw vw w (21 seconds ago.)chalets in dubai (22 seconds ago.)height 48px (23 seconds ago.)komering ulu (23 seconds ago.)секреты работы с госзакупками и контрактного кредитования (24 seconds ago.)ahover td-theme-wrap tdi1702d (25 seconds ago.)francetvinfo.fr en direct (27 seconds ago.)psd to html5 (28 seconds ago.)not recognize (29 seconds ago.)tinypic image url (30 seconds ago.)urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincur auto (33 seconds ago.)新手如何选到对的车?选好车技巧须知 (36 seconds ago.)lettori multimediali (38 seconds ago.)