Airtel.in Summary

Airtel.in  |  India's leading provider of prepaid & postpaid, wireless internet, broadband, fixed line, digital TV & mobile services. Get my airtel app to manage all your services.
Low trust score  | 
Airtel 4G - Prepaid | Postpaid | Broadband | Payments Bank| DTH


Airtel.in has a Low Trust Score, and a Statvoo Rank of C.

Airtel.in is hosted by BHARTI Airtel Ltd. in Uttar Pradesh, Noida, India, 201301.
Airtel.in has an IP Address of 125.21.240.13 and a hostname of mail.airtel.in and runs Apache web server.

The domain airtel.in was registered 1 decade 5 years 1 week ago by INRegistry, it was last modified 5 years 3 weeks 6 days ago and currently is set to expire 3 years 11 months 1 week from now.

It is the world's 1,208 most popular site among over 300 million websites.

Airtel.in has a total of 0 backlinks.

Airtel.in gets approximately 1,150,628 unique visitors a day and 12,384,104 pageviews per day.

Airtel.in has an estimated worth of $13374720.
An average daily income of approximately $12384, which is wroughly $376,680 per month.

Whois information for airtel.in

Full Whois Lookup for Airtel.in Whois Lookup

Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only, and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.

Domain ID:D15987-AFIN
Domain Name:AIRTEL.IN
Created On:06-Jan-2005 03:10:05 UTC
Last Updated On:24-Dec-2014 12:10:30 UTC
Expiration Date:06-Jan-2024 03:10:05 UTC
Sponsoring Registrar:Net4India (R7-AFIN)
Status:CLIENT TRANSFER PROHIBITED
Reason:
Registrant ID:N8R384062
Registrant Name:Nupur Khanna
Registrant Organization:Bharti Airtel Limited
Registrant Street1:Bharti Crescent ,1, Nelson Mandela Marg, Vasant Kunj, Phase III
Registrant Street2:
Registrant Street3:
Registrant City:New Delhi
Registrant State/Province:DL
Registrant Postal Code:110070
Registrant Country:IN
Registrant Phone:+91.1146666100
Registrant Phone Ext.:
Registrant FAX:
Registrant FAX Ext.:
Registrant Login to show email
ID:N8A30890721
Admin Name:Nupur Khanna
Admin Organization:Bharti Airtel Limited
Admin Street1:Bharti Crescent ,1, Nelson Mandela Marg, Vasant Kunj, Phase III
Admin Street2:
Admin Street3:
Admin City:New Delhi
Admin State/Province:DL
Admin Postal Code:110070
Admin Country:IN
Admin Phone:+91.1146666100
Admin Phone Ext.:
Admin FAX:
Admin FAX Ext.:
Admin Login to show email
ID:N8T30890721
Tech Name:Nupur Khanna
Tech Organization:Bharti Airtel Limited
Tech Street1:Bharti Crescent ,1, Nelson Mandela Marg, Vasant Kunj, Phase III
Tech Street2:
Tech Street3:
Tech City:New Delhi
Tech State/Province:DL
Tech Postal Code:110070
Tech Country:IN
Tech Phone:+91.1146666100
Tech Phone Ext.:
Tech FAX:
Tech FAX Ext.:
Tech Login to show email
Server:AAADEL.MANTRAONLINE.COM
Name Server:DNSDEL.MANTRAONLINE.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned

Who hosts Airtel.in?

Airtel.in Web Server Information

Hosted IP Address:125.21.240.13
Hosted Hostname:mail.airtel.in
Service Provider:BHARTI Airtel Ltd.
Hosted Country:IndiaIN
Location Latitude:28.57
Location Longitude:77.32
Webserver Software:Apache

HTTP Header Analysis for Airtel.in

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 08 Jun 2015 03:00:47 GMT
Server: IBM_HTTP_Server
X-Powered-By: Servlet/3.0
ETag: 596385971
Content-Length: 25557
Cache-Control: max-age=604800
Expires: Sun, 14 Jun 2015 19:15:10 GMT
Content-Language: en-US
Age: 3767
Content-Type: text/html; charset=UTF-8

Need to find out who hosts Airtel.in?

Airtel.in Free SEO Report

Website Inpage Analysis for Airtel.in

H1 Headings:3
Get unlimited postpaid plan
Prepaid SIM
Streaming Stick for your TV
H2 Headings:21
Order Online for doorstep delivery
Unlimited Postpaid
Order Online, Doorstep Delivery
Great Value on Handsetsat affordable EMI
Only on Airtel
Buy Smartphones
Great Value, Affordable EMI
Manage Accounts,recharge, pay Bills
On Airtel Thanks App
Get Airtel Thanks App
Recharge, Pay Bills, Get Help
Join India’s first Payment Bank
Instant Account opening. Great interest rates.
Join Payment Bank
Instant Account. Smart Savings
Now at your doorstep
Prepaid SIM
Now at your doorstep
With Airtel Xstream
Streaming Stick for your TV
With Airtel Xstream
H3 Headings:12
Back to top  
Quick Access
Broadband Plans
Quick Access
Postpaid Plans
Unlimited Postpaid Plans
Family Postpaid Plans
Digital Tv Plans
Help at Hand
New Connections
About Airtel
Back to top  
H4 Headings:12
Recharge or Pay bills
Airtel Postpaid at Rs 499Unlimited Calling, 75GB data,Netflix, Amazon Prime
Airtel Postpaid at Rs 499Unlimited Calling, 75GB data, Netflix, Amazon Prime
Enjoy Netflix, Amazon Prime & Zee5 Videos with Airtel Broadband
Get Unlimited calling in India with Prepaid recharge, 1.5GB/day & Airtel Thanks benefits Rs.249 for 28 days
Apps, movies, games and TV channels – all now on your TV with Airtel Xstream Box
Introducing the all new myCare
Manage all your  accounts here!
Get exclusive Offers &account information at one place.
Watch Latest Movies, Live Tv shows and many more on Airtel Xstream App
Get Unlimited Free Music at Wynk Music
Listen to your favorites on Wynk Music
H5 Headings:1
Cart
H6 Headings:30
{{product.item.doc.bundleDisplayName}}
Pay & Recharge
Pay Bill
Recharge
Add Money
Buy
FOR ME
Postpaid
Apps
Other Services
For Home
Internet
DTH
Broadband & fixedline
Exciting Offers
Payments Bank
Accounts
Transact
Wallet
Transact
Payments Bank
Pay Bill
Recharge
Add Money
FOR ME
FOR HOME
Broadband & fixedline
Get Exciting Offers
Accounts
Wallet
Total IFRAMEs:0
Total Images:21
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Airtel.in

nbspmoreget an accounttransactaddamp fixedinfinitynow nbspaccounttransactadd moneypay billsrechargetransferviewmoneypayaccounttransactadd moneypayvarplansmoregetbillsrechargetransferviewfamilyyourfixedmoneypay billsrechargetransferviewplanallamptruenowbanksavingsaccounttransactaddpostpaid

Longtail Keyword Density for Airtel.in

KeywordsOccurences
accounttransactadd moneypay billsrechargetransferview4
moreget an accounttransactadd4
moneypay billsrechargetransferview6
amp fixed5
accounttransactadd moneypay4
now nbsp3
amp10
nbsp8
your8
billsrechargetransferview6
moneypay6
moreget6
fixed5
infinity4
family4
plan4
plans4
accounttransactadd4
banksavings4
var3
true3
all3
postpaid3
now3

What are the nameservers for airtel.in?

Airtel.in Domain Nameserver Information

HostIP AddressCountry
aaadel.mantraonline.com 202.56.230.6India India
dnsdel.mantraonline.com 202.56.230.5India India

Airtel.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Airtel.in is a scam?