Airtelhellotunes.in  |  airtel hello tunes - search and get it online
Low trust score  | 
make your favorite song your airtel hello tunes. copy, share and even gift your friends.

Airtelhellotunes.in Website Information

Airtelhellotunes.in has a Low Trust Score, a Statvoo Rank of F, an Alexa Rank of 114,862, a Majestic Rank of 0, a Domain Authority of 22% and is not listed in DMOZ.

Airtelhellotunes.in is hosted by BHARTI Airtel Ltd. in Delhi, Delhi, India, 110020.
Airtelhellotunes.in has an IP Address of 203.101.110.168 and a hostname of 203.101.110.168.

The domain airtelhellotunes.in was registered 7 years 5 months 3 weeks ago by , it was last modified 4 years 4 months 1 week ago and currently is set to expire 1 year 5 months 4 weeks ago.


Whois information for airtelhellotunes.in

Full Whois Lookup for Airtelhellotunes.in Whois Lookup

Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only, and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.

Domain ID:D5727198-AFIN
Domain Name:AIRTELHELLOTUNES.IN
Created On:16-Jan-2012 11:47:49 UTC
Last Updated On:03-Mar-2015 18:20:21 UTC
Expiration Date:16-Jan-2018 11:47:49 UTC
Sponsoring Registrar:Endurance Domains Technology LLP (R173-AFIN)
Status:CLIENT TRANSFER PROHIBITED
Reason:
Registrant ID:DI_12155331
Registrant Name:Sourabh Goyal
Registrant Organization:Comviva Technologies Limited
Registrant Street1:A 26
Registrant Street2:Info City
Registrant Street3:Sector-34
Registrant City:Gurgaon
Registrant State/Province:Haryana
Registrant Postal Code:122001
Registrant Country:IN
Registrant Phone:+091.1244819023
Registrant Phone Ext.:
Registrant FAX:
Registrant FAX Ext.:
Registrant Login to show email
ID:DI_12155331
Admin Name:Sourabh Goyal
Admin Organization:Comviva Technologies Limited
Admin Street1:A 26
Admin Street2:Info City
Admin Street3:Sector-34
Admin City:Gurgaon
Admin State/Province:Haryana
Admin Postal Code:122001
Admin Country:IN
Admin Phone:+091.1244819023
Admin Phone Ext.:
Admin FAX:
Admin FAX Ext.:
Admin Login to show email
ID:DI_12155331
Tech Name:Sourabh Goyal
Tech Organization:Comviva Technologies Limited
Tech Street1:A 26
Tech Street2:Info City
Tech Street3:Sector-34
Tech City:Gurgaon
Tech State/Province:Haryana
Tech Postal Code:122001
Tech Country:IN
Tech Phone:+091.1244819023
Tech Phone Ext.:
Tech FAX:
Tech FAX Ext.:
Tech Login to show email
Server:51876.MERCURY.ORDERBOX-DNS.COM
Name Server:51876.VENUS.ORDERBOX-DNS.COM
Name Server:51876.EARTH.ORDERBOX-DNS.COM
Name Server:51876.MARS.ORDERBOX-DNS.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned

Who hosts Airtelhellotunes.in?

Airtelhellotunes.in Web Server Information

Hosted IP Address:203.101.110.168
Hosted Hostname:203.101.110.168
Service Provider:BHARTI Airtel Ltd.
Hosted Country:IndiaIN
Location Latitude:28.6667
Location Longitude:77.2167
Webserver Software:Not Applicable

HTTP Header Analysis for Airtelhellotunes.in

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 06 Jul 2015 07:47:06 GMT
Server: Apache
X-Powered-By: PHP/5.3.6
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 11174
Content-Type: text/html; charset=UTF-8


Need to find out who hosts Airtelhellotunes.in?

Airtelhellotunes.in Free SEO Report

Website Inpage Analysis for Airtelhellotunes.in

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Airtelhellotunes.in

ifpageloadtrue pageloadlangvalueshiftlangvalsplit elseloadsodlangvalsplit else ifcachecirclevallangvaldata else loadershowsubsection1split subsection2popstopsound channel hellotuneselse langvalue langvalsplityoudataname herelangvaluelangvalueshift langvaluenumberregional pagename hellotunessubsection1split subsection2pop subsection2channel hellotunescasesethellotunes browse varlangvalue langvalsplitjoindigital tvbrowsedocumentreadyfunctionnewelse ifcachecirclevallangvallangvalue else langvaluepgsclickidhidefalse else satellitetrackslpvpsubsection1nameselectelse satellitetrackslpvp ifcirclevallangvalsplitjoincase htvar hidqueryhomesubcatfalsetonesearchcircleval10songlangvaldatedesc success functiondatafalse varht var urlelse pgsclickidhidehidquerytonesearchcircleval10songlangvaldatedesc successcentercontenthtmldatalangvalueshift langvalue langvaluejoinplansifcachecirclevallangval ifcirclevalsubsection2join ifpageloadtrue pageloadpgsclickidshowgetvar langvalue langvalsplitjoinelse ifcachecirclevallangval ifcirclevalfontweightnormal color514f50 footertop2pleasefunctiondata centercontenthtmldataelse loadershowdata else pgsclickidhidesearch keywordmobile nofontweightnormal color514f50radiobuttonvaluepagename hellotunes browsevalidcentercontenthtmldata loaderfadeout pgsclickidshowhello tuneslangvalsatellitetrackslpvp ifcircleval regionalstopsound channellangvalue elsepagename hellotunesslp circleval langvaluetunesulmenuusersetifcircleval langvalsubsection1 circleval langvaluevar hidquery documentgetelementbyidhidqueryvalueloadershowifpageloadtruepasswordht varaccountfalse elsebroadbandpagenamebreakloadershow ajaxtonesearchcircleval10songlangvaldatedeschellotunes browseurl tonesearchcircleval10songlangvaldatedesctunesubsection2join ifpageloadtruecolor514f50loadershow centercontenthtmlcachecirclevallangvalcircleval langvalue subsection10pxifcachecirclevallangvalsatellitetrackslpvp ifcirclevalhellotunes browse slpifcachecirclevallangval ifcircleval langvalreturn false varpageload false elseajax urlbrowse slpchannelcachecirclevallangvalcentercontenthtmlcachecirclevallangval loaderfadeouthellotuneslangvalue subsection2footertop2browse varbrowse var langvaluelangvaluejoin pagename hellotunessuccess functiondata centercontenthtmldatasubsection2 subsection2joinmoreinnerheight264url tonesearchcircleval10songlangvaldatedesc successlangvalsplitlangvalue langvaluejoin pagenamelangvalue subsection1 circlevalloadershow centercontenthtmlcachecirclevallangval loaderfadeoutsatellitetrackslpvpswitchtypeajax url tonesearchcircleval10songlangvaldatedescairtelifcirclevallangvalsplit langvalueshiftfontsize11pxifmacmovalpgsclickidhide loadershow ajaxenterhidquery documentgetelementbyidhidqueryvalue varyour favoritelangvalue langvalsplit langvalueshiftsubsection1splitfontsize11px fontweightnormal color514f50ifcircleval regionalhidquery documentgetelementbyidhidqueryvaluecircleval langvalue elselangvaluejoindocumentgetelementbyidhidqueryvalue varfunctionlangvalue subsection1channel hellotunes browsesubsection2pop subsection2 subsection2joinurlnbspvar langvaluebrowse slp circlevalsubsection2 subsection1splitswitchtype casehellosearchvar langarr langvalsplitpgsclickidhide loadershowlangarr langvalsplit elseyourlangvalue subsection2 subsection1splitfontweightnormalvar langarryour namemobile numberreturn falsesubsection1 circlevalsubsection2 subsection1split subsection2popcircleval langvalue subsection2var urlfunctiondatayour hellotunessubsection2regionallangarrregional pagenameifcircleval regional pagenamekeywordalertpleasemacverfgoattrhreflangvalue langvalsplitsuccess functiondatafontsize11px fontweightnormalelsecachecirclevallangval dataalertplease entersubsection2jointruelangarr langvalsplitcolor514f50 footertop2your callersswitchtype case htvalidatesearchajaxcirclecachecirclevallangval data elseelse satellitetrackslpvpmobileregional var langarrtvlangvalsplit langvalueshift langvaluelangvalue langvaluejoinsubsection2 subsection2join ifpageloadtrueloaderfadeoutsubsection2poplangvaluejoin pagenameiptvcallerspageloadcircleval langvaluereturnsubsection2pop subsection2varelse langvalueifcentercontenthtmldata loaderfadeoutstopsoundloadershow ajax urlfavoritefunctiondata centercontenthtmldata loaderfadeoutcirclevalenter youryour name herecase ht varnoregional varsuccesspageload falsedocumentgetelementbyidhidqueryvaluedata elseht0px 0pxslploaderfadeout pgsclickidshowhereelse pgsclickidhide loadershowyour mobilecentercontenthtmlcachecirclevallangvalifpageloadtrue pageload falselocationhrefifcircleval regional vardigitalslp circleval

Longtail Keyword Density for Airtelhellotunes.in

KeywordsOccurences
pagename hellotunes browse8
hellotunes browse slp8
functiondata centercontenthtmldata loaderfadeout7
loadershow ajax url7
success functiondata centercontenthtmldata7
slp circleval langvalue6
browse slp circleval6
langvalue langvaluejoin pagename4
langvaluejoin pagename hellotunes4
langvalue langvalsplit-- langvalueshift4
subsection1 circleval langvalue4
else langvalue langvalsplit--4
langvalsplit-- langvalueshift langvalue4
subsection2 subsection1split subsection2pop4
ifcachecircleval--langval ifcircleval langval4
cachecircleval--langval data else4
loadershow centercontenthtmlcachecircleval--langval loaderfadeout4
var langarr langvalsplit--4
subsection2pop subsection2 subsection2join4
langvalue subsection2 subsection1split4
subsection1split subsection2pop subsection24
circleval langvalue subsection24
langvalueshift langvalue langvaluejoin4
else pgsclickidhide loadershow4
var hidquery documentgetelementbyidhidqueryvalue4
hidquery documentgetelementbyidhidqueryvalue var4
data else pgsclickidhide4
centercontenthtmldata loaderfadeout pgsclickidshow4
regional pagename hellotunes4
pgsclickidhide loadershow ajax4
return false var4
stopsound channel hellotunes4
var langvalue langvalsplit--join4
ifcircleval regional pagename4
hellotunes browse var4
browse var langvalue4
channel hellotunes browse4
case ht var3
langvalsplit-- else ifcachecircleval--langval3
ht var url3
ajax url tonesearchcircleval10songlangvaldatedesc3
langarr langvalsplit-- else3
else ifcachecircleval--langval ifcircleval3
tonesearchcircleval10songlangvaldatedesc success functiondata3
font-weightnormal color514f50 footertop23
font-size11px font-weightnormal color514f503
switchtype case ht3
regional var langarr3
url tonesearchcircleval10songlangvaldatedesc success3
subsection2 subsection2join ifpageloadtrue3
circleval langvalue subsection13
langvalue subsection1 circleval3
your name here3
langvalue else langvalue3
circleval langvalue else3
data else loadershow3
subsection2join ifpageloadtrue pageload3
else satellitetrackslp-vp ifcircleval3
satellitetrackslp-vp ifcircleval regional3
false else satellitetrackslp-vp3
pageload false else3
ifpageloadtrue pageload false3
ifcircleval regional var3
hellotunes browse12
circleval langvalue10
return false10
pagename hellotunes9
var url8
loaderfadeout pgsclickidshow8
pgsclickidhide loadershow8
browse slp8
success functiondata8
ajax url8
loadershow ajax7
data else7
ifcircleval regional7
centercontenthtmldata loaderfadeout7
functiondata centercontenthtmldata7
slp circleval6
channel hellotunes5
font-weightnormal color514f505
langvaluejoin pagename4
subsection1 circleval4
langvalue subsection24
subsection2 subsection1split4
langvalue langvaluejoin4
langvalsplit-- langvalueshift4
langvalueshift langvalue4
subsection1split subsection2pop4
langvalue langvalsplit--4
subsection2 subsection2join4
loadershow centercontenthtmlcachecircleval--langval4
langarr langvalsplit--4
cachecircleval--langval data4
ifcachecircleval--langval ifcircleval4
centercontenthtmlcachecircleval--langval loaderfadeout4
your favorite4
ifcircleval langval4
var langarr4
0px 0px4
subsection2pop subsection24
else langvalue4
var hidquery4
documentgetelementbyidhidqueryvalue var4
stopsound channel4
else pgsclickidhide4
search keyword4
false else4
false var4
alertplease enter4
hidquery documentgetelementbyidhidqueryvalue4
browse var4
var langvalue4
langvalue langvalsplit--join4
regional pagename4
tonesearchcircleval10songlangvaldatedesc success3
url tonesearchcircleval10songlangvaldatedesc3
case ht3
switchtype case3
ht var3
your callers3
else ifcachecircleval--langval3
your hellotunes3
mobile no3
font-size11px font-weightnormal3
your name3
color514f50 footertop23
else satellitetrackslp-vp3
langvalue subsection13
your mobile3
enter your3
name here3
digital tv3
langvalue else3
mobile number3
subsection2join ifpageloadtrue3
regional var3
else loadershow3
satellitetrackslp-vp ifcircleval3
hello tunes3
ifpageloadtrue pageload3
pageload false3
langvalsplit-- else3
var61
else23
your23
langvalue22
hellotunes21
url19
loadershow14
loaderfadeout14
return13
ifcircleval13
false13
function12
browse12
circleval10
enter10
mobile10
subsection29
pagename9
circle9
pgsclickidhide8
0px8
functiondata8
success8
regional8
pgsclickidshow8
slp8
langvalsplit--8
ajax8
centercontenthtmldata7
data7
stopsound7
plans6
tunes6
broadband6
tune6
locationhref5
airtel5
name5
case5
break5
subsection15
number5
channel5
tv5
font-weightnormal5
color514f505
search5
subsection2join4
langvaluejoin4
langvalsplit--join4
subsection1split4
langvalueshift4
documentgetelementbyidhidqueryvalue4
hidquery4
subsection2pop4
pageload4
alertplease4
if4
home4
centercontenthtmlcachecircleval--langval4
favorite4
here4
nbsp4
please4
cachecircleval--langval4
true4
new4
langarr4
satellitetrackslp-vp4
ifcachecircleval--langval4
langval4
keyword4
tonesearchcircleval10songlangvaldatedesc3
font-size11px3
footertop23
set3
subcat3
callers3
ifpageloadtrue3
ulmenuuserset3
you3
radiobuttonvalue3
documentreadyfunction3
validatesearch3
account3
select3
more3
hello3
digital3
iptv3
get3
password3
switchtype3
ht3
macverfgoattrhref3
valid3
no3
loadsod3
ifmacmoval3
innerheight2643

What are the nameservers for airtelhellotunes.in?


Airtelhellotunes.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Airtelhellotunes.in is a scam?