American Kennel Club

Safety: High trust score
Year Founded: 1995
Global Traffic Rank: 3,921
Estimated Worth: $4,120,200
Category: Pets and Animals > Pets

The AKC is the recognized and trusted expert in breed, health and training information for dogs.



Domain summary

Last updated
2022-02-14
Domain label
akc
Domain extension
org
Domain registered:
1995-04-06
Domain updated:
2022-02-14
Global Traffic Rank
3,921
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$4,120,200
Estimated daily income
$3,815
Estimated monthly income
$116,040

Frequently Asked Questions (FAQ)

Q: When was Akc.org registered?
A: Akc.org was registered 27 years, 1 month, 1 week, 6 days, 5 hours, 19 minutes, 46 seconds ago on Thursday, April 6, 1995.
Q: When was the WHOIS for Akc.org last updated?
A: The WHOIS entry was last updated 3 months, 5 days, 5 hours, 19 minutes, 46 seconds ago on Monday, February 14, 2022.
Q: What are Akc.org's nameservers?
A: DNS for Akc.org is provided by the following nameservers:
  • ns3.akc.org
  • ns1.akc.org
  • ns2.akc.org
Q: Who is the registrar for the Akc.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Akc.org?
A: Akc.org ranks 3,921 globally on Alexa. Akc.org has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Akc.org each day?
A: Akc.org receives approximately 476,919 visitors and 3,815,352 page impressions per day.
Q: What IP address does Akc.org resolve to?
A: Akc.org resolves to the IPv4 address 23.185.0.4.
Q: In what country are Akc.org servers located in?
A: Akc.org has servers located in the United States.
Q: What webserver software does Akc.org use?
A: Akc.org is powered by Nginx webserver.
Q: Who hosts Akc.org?
A: Akc.org is hosted by OJSC Vimpelcom in United States.
Q: How much is Akc.org worth?
A: Akc.org has an estimated worth of $4,120,200. An average daily income of approximately $3,815, which is roughly $116,040 per month.

Akc.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Akc.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Akc.org

H1 Headings

1 :
  1. For the Love of All Things Dog

H2 Headings

18 :
  1. Top Stories
  2. Trending News
  3. Find The Right Breed
  4. AKC Cares
  5. AKC Canine Health Foundation
  6. AKC Canine Health Foundation
  7. Rescue Network
  8. Rescue Network
  9. AKC Reunite
  10. AKC Reunite
  11. AKC Humane Fund
  12. AKC Humane Fund
  13. Museum of the Dog
  14. Museum of the Dog
  15. Protecting Your Rights
  16. Protecting Your Rights
  17. Sports & Events
  18. Register Your Dog

H3 Headings

45 :
  1. Breed Explorer
  2. Choosing The Right Breed
  3. Prospective Owners
  4. Additional Resources
  5. Featured
  6. Browse By Topic
  7. Tools & Quizzes
  8. Additional Resources
  9. Products
  10. Services
  11. Featured Products
  12. Shop The AKC Store
  13. GETTING STARTED IN DOG SPORTS
  14. Featured Events
  15. Browse All Dog Sports
  16. RESOURCES FOR DOG SPORT PARTICIPANTS
  17. Find a Club
  18. Clubs Offering:
  19. Clubs
  20. For Delegates
  21. Government Relations
  22. AKC Library & Archives
  23. Conformation
  24. Agility
  25. Rally
  26. Fast CAT
  27. Virtual Home Manners
  28. Scent Work
  29. Obedience
  30. Tracking
  31. Herding
  32. Earth Dog
  33. Field Trials
  34. Hunting
  35. Farm Dog Certified
  36. Lure Coursing
  37. Coursing Ability
  38. Coonhound
  39. Trick Dog
  40. Learn Why
  41. ABOUT AKC +
  42. Top Services +
  43. Top Resources +
  44. Get Involved +
  45. Favorite Things +

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

39 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

257:

Links - Internal (nofollow)

0:

Links - Outbound

28:

Links - Outbound (nofollow)

0:

Keyword Cloud for Akc.org

productssearchmatchaustralianbull terriercattlewater spanielakc rescuejuniorcanine collegedelegatesconformation dog showsentlebucher mountain dogresponsible dog ownershipgroupschnauzerfastcaninedog australianreunite akcakctvdownloadable formsgermanresourcesbulldogtopyour dog findchampionshiprightgreatvizslaprotecting yournorwegianspringer spanieltestnewsnamedogakc nationaleattrainingnewamericanmountainyour rightsitsfind a clubterrier americanotherakc reunitetheyrightsmanchesteryouclub clubwelsh corgiamp archivesservicespyreneanfamilysports ampminutesdepartmentshepherdeventswelshkaicenternewsletterampdog name finderregisterhumanelifestyleownerspetshouldlapphundmost popular dogprogramsmost popularrelationstvregisterednationalresponsiblestarted in dogbassetdownloadable forms rulespopularpuppy registerdog trainingakc humane fundsupportbestperformancepointingdoall dogschowakc canine healthagilitycontactpointersincekelpierussianpress centercompanionyoureventakc rescue networkyour matchcorgidownloadabledog finddelegateakc library ampmostleopardshop akcnoncompetitivedogs bestdog sportsakctv akcentlebucher mountainwatchhoundbordergreyhoundspanieldog namegriffonfox terrierrescue networknational championshipmountain doganswerdogswirehaired pointermastiffbreedingbasset griffon vendenreportshandlerourtrickmanchester terriervendenworkingspitzslovenskycansetter irishcocker spanielfind your matchgriffon vendenminiaturebreedresponsible dogconformationtodayeducation akc canineakcopenfamily dogmuseumspanishnetwork akctreeingregister yoursports amp eventsinformationpressvirtualpinscherfrenchlibrary amp archivesdirectorykenownershipscottishobedienceyour dogsfarm dogswedishifgovernment relationsfarmakc libraryreunitecareright breedlargestdifferentfoundationchinesetitleeducation akcakctv akc magazineslearn about akcsetterfind the rightshowname findermagazinesgovernment relations departmentexpert advicecompare breedspopular dogallclubsmixedhuntreports akcworkmanagementhomeexpertscentarchivesnetworkhumane fundrulesfindformscattle dog australianpuppylibrary ampdog breedfeaturedcollegecockerconformation dogsportssportfoxhoundretrieverwhyscent workshepherd dogjudgesadvicetestswater dogakc canine collegerelations departmentadditional resourcesirishall dogamp servicespointer germanfinnishrescueamp eventstipsjuniorsprogramcoursingwhichwhitetibetanblackcatprovidingabilityakc delegateforms rulespassfailnameshuntingcattle dogakc tvfinderproducts shophealth foundationcollieitalianopromotefundinvitationalspringerquestionswirehairedbreedsakc canineakc magazinesbreed clublegislativerecognitionbelgianregister your dogchampionship akcgroomingportuguese podengopoodlebasset griffonyour dogenrolltoyherdingdonatestaffordshiredog ownershipfieldpodengopurebreddog showsgetting startedevent searchclubfind yourdog namessmallakc humanemixed breedrussellterrier standardawardscoonhoundshowshairlessromanianboardridgebackfind a puppyeducationalaskanusentlebucherregistrationbulltheirstartedregulationspuppy register yourcanine health foundationbrowsepolicyprotectinglibrarycanine healthshoplearncompareowneradditionalsheepdogbraquewatertrackinginfoportuguesestandardall breedsonerussell terrierresources findpuppieshealthbreederpopular dog breedsselectgetenglishbreeds findprotecting your rightsgovernmenttitle recognitiondog breedsrallyspaniel englishjapanesebrowse allterrierdedicateddog ownersfoxportalakc reunite akcmorethroughgetting

Longtail Keyword Density for Akc.org

KeywordsOccurences
register your dog8
find a puppy6
started in dog6
learn about akc6
akc humane fund6
akc canine college6
sports amp events5
canine health foundation5
akc library amp5
library amp archives5
find your match5
akc canine health5
basset griffon venden4
find the right4
cattle dog australian4
akc reunite akc4
akctv akc magazines4
puppy register your4
find a club3
protecting your rights3
government relations department3
akc rescue network3
downloadable forms rules3
conformation dog shows3
education akc canine3
dog name finder3
popular dog breeds3
most popular dog3
your dog find3
entlebucher mountain dog3
responsible dog ownership3
your dog18
dog sports14
akc canine12
shepherd dog10
dog breeds9
government relations9
mountain dog9
register your8
fox terrier6
canine college6
rescue network6
bull terrier6
akc national6
akc humane6
humane fund6
canine health6
dog owners5
amp archives5
your match5
find your5
dog ownership5
sports amp5
education akc5
library amp5
akc library5
akc reunite5
health foundation5
dog training5
dog find5
amp events5
breed club4
puppy register4
club club4
dog shows4
responsible dog4
downloadable forms4
akctv akc4
akc magazines4
championship akc4
reunite akc4
national championship4
browse all4
akc delegate4
event search4
dog australian4
manchester terrier4
welsh corgi4
cocker spaniel4
spaniel english4
springer spaniel4
additional resources4
cattle dog4
water spaniel4
pointer german4
wirehaired pointer4
terrier american4
basset griffon4
griffon venden4
setter irish4
terrier standard4
amp services4
getting started4
russell terrier4
expert advice4
water dog4
portuguese podengo4
dog breed3
all breeds3
relations department3
breeds find3
akc tv3
protecting your3
your rights3
all dogs3
shop akc3
scent work3
forms rules3
family dog3
resources find3
mixed breed3
farm dog3
dogs best3
most popular3
popular dog3
compare breeds3
right breed3
dog name3
name finder3
dog names3
press center3
title recognition3
products shop3
reports akc3
akc rescue3
network akc3
entlebucher mountain3
all dog3
conformation dog3
your dogs3
dog159
akc104
terrier81
amp46
your36
find35
spaniel28
sports26
breed24
breeds24
dogs23
club22
shepherd22
all21
american19
canine19
hound18
events17
services17
training16
sheepdog16
search16
resources15
puppy15
english14
event14
health14
mountain13
retriever12
german12
pointer12
delegate12
toy11
register11
relations11
coonhound11
you11
program10
portuguese10
breeder10
products10
irish10
mastiff10
miniature10
national10
australian10
group9
shop9
government9
browse8
center8
japanese8
rescue8
setter8
network8
wirehaired8
welsh8
italiano8
clubs8
water8
learn8
belgian8
fund8
basset8
griffon8
library8
legislative7
started7
do7
obedience7
get7
owners7
archives7
rights6
tibetan6
bull6
poodle6
fox6
championship6
humane6
match6
responsible6
bulldog6
top6
right6
scent6
norwegian6
foundation6
their6
our6
field6
spitz6
pyrenean6
schnauzer6
college6
russian6
pinscher6
education6
standard6
collie6
best6
most5
delegates5
reports5
expert5
ownership5
museum5
home5
reunite5
info5
directory5
herding5
agility5
department5
can5
sport5
open5
shows5
tracking5
rally5
work4
ability4
magazines4
trick4
juniors4
cat4
akctv4
test4
hunting4
which4
judges4
fast4
registered4
coursing4
other4
performance4
companion4
care4
information4
conformation4
enroll4
invitational4
downloadable4
forms4
virtual4
pet4
minutes4
handler4
getting4
finnish4
greyhound4
slovensky4
scottish4
border4
ridgeback4
podengo4
russell4
foxhound4
manchester4
leopard4
ken4
white4
great4
swedish4
staffordshire4
venden4
french4
lapphund4
cattle4
kelpie4
springer4
cocker4
chow4
chinese4
corgi4
black4
spanish4
romanian4
treeing4
compare4
advice4
lifestyle4
featured4
name4
purebred4
vizsla4
why4
alaskan4
additional4
braque4
working4
kai4
pointing4
family4
today3
support3
tv3
non-competitive3
donate3
dedicated3
tests3
one3
if3
its3
new3
policy3
since3
hairless3
watch3
tips3
providing3
us3
through3
they3
select3
more3
protecting3
names3
newsletter3
puppies3
programs3
largest3
answer3
questions3
different3
registration3
popular3
should3
owner3
breeding3
press3
grooming3
news3
finder3
mixed3
small3
board3
regulations3
portal3
promote3
contact3
entlebucher3
awards3
management3
rules3
show3
eat3
junior3
farm3
hunt3
recognition3
title3
passfail3

Who hosts Akc.org?

Akc.org Hosting Provider Information

Hosted IP Address:23.185.0.4
Hosted Hostname:23.185.0.4
Service Provider:OJSC Vimpelcom
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:nginx

Is "OJSC Vimpelcom" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.9161%
GOOGLE
14.0532%
AS-26496-GO-DADDY-COM-LLC
3.4879%
NAMECHEAP-NET
3.1470%
AMAZON-AES
2.2136%
GoDaddy.com, LLC
2.0287%
UNIFIEDLAYER-AS-1
1.9645%
Fara Negar Pardaz Khuzestan
1.6143%
CONFLUENCE-NETWORK-INC
1.4660%
1&1 Internet AG
1.3358%
OJSC Vimpelcom
0.0160%

HTTP Header Analysis for Akc.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: keep-alive
Content-Length: 72434
Cache-Control: public, max-age=600
Content-Encoding: gzip
Content-Type: text/html; charset=UTF-8
Link:; rel="https://api.w.org/"
Server: nginx
Strict-Transport-Security: max-age=300
Traceparent: 00-0be6063e1f6e45389532bcadf19421d5-5b484b9aeab053bf-00
X-Cloud-Trace-Context: 0be6063e1f6e45389532bcadf19421d5/6577590384509080511;o=0
X-Pantheon-Styx-Hostname: styx-fe4-a-6cdc754b6c-t66m6
X-Styx-Req-Id: 841e631f-8d33-11ec-bba2-ca51e363301b
Date: Mon, 14 Feb 2022 01:15:48 GMT
X-Served-By: cache-mdw17330-MDW, cache-lcy19221-LCY
X-Cache: HIT, MISS
X-Cache-Hits: 1, 0
X-Timer: S1644801348.429810,VS0,VE93
Vary: Accept-Encoding, Cookie, Cookie
Age: 52
Accept-Ranges: bytes
Via: 1.1 varnish, 1.1 varnish

Akc.org Domain Nameserver Information

HostIP AddressCountry
ns3.akc.org 40.143.46.130United States United States
ns1.akc.org 74.203.101.131United States United States
ns2.akc.org 74.203.101.132United States United States


Need to find out who hosts Akc.org?


Domain Registration (WhoIs) information for Akc.org

 Domain Name: AKC.ORG
Registry Domain ID: D3079776-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.whois.godaddy.com
Updated Date: 2021-05-28T18:30:40Z
Creation Date: 1995-06-04T04:00:00Z
Registry Expiry Date: 2029-06-03T04:00:00Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: Domains By Proxy, LLC
Registrant State/Province: Arizona
Registrant Country: US
Name Server: NS1.AKC.ORG
Name Server: NS2.AKC.ORG
Name Server: NS3.AKC.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2022-02-14T01:14:50Z

Websites with Similar Names

Akc-bd.com
AHMED KHAN CO. | Leading Chartered Accountant firm of Bangladesh
Akc-edu.xyz
???????????
Akc-europe.com
Site not found
Akc-golf.com
秋田北クラシックゴルフ倶楽部
Akc-gov.xyz
VOTO?????

Recently Updated Websites

Liontedcruz.com (10 seconds ago.)Thealtarofthekingdomofgod.com (12 seconds ago.)Usawoalordfairfax.org (13 seconds ago.)Vipsmoketobacco.com (16 seconds ago.)R2j-group.com (17 seconds ago.)Socds.com (19 seconds ago.)A1hr.in (23 seconds ago.)Gundogdumotorsaksaray.com (25 seconds ago.)Binz-ferienwohnungen-ruegen.de (31 seconds ago.)Daddoadvice.com (32 seconds ago.)Tedrogersresearch.ca (34 seconds ago.)Swedish.hospital (39 seconds ago.)3rbc.net (51 seconds ago.)Kellyharman.com (53 seconds ago.)Visoroptics.com (57 seconds ago.)Alacarte.tv (1 minute 5 seconds ago.)Plytek.fun (1 minute 7 seconds ago.)Sabrinalieb.com (1 minute 13 seconds ago.)Topbeton.su (1 minute 16 seconds ago.)Goldenhillspestcontrol.com (1 minute 20 seconds ago.)Devnt.com (1 minute 21 seconds ago.)Huile-penrite.fr (1 minute 22 seconds ago.)Kanxiaoshuo.net (1 minute 30 seconds ago.)Grumpypals.com (1 minute 31 seconds ago.)Costasumba.com (1 minute 37 seconds ago.)Rajoyideasgratis.blogspot.com.es (1 minute 38 seconds ago.)Shipwego.com (1 minute 45 seconds ago.)Rainews.it (1 minute 47 seconds ago.)Drinkforlifes.com (1 minute 48 seconds ago.)Thelastest.com (1 minute 49 seconds ago.)

Recently Searched Keywords

that girl lay lay dad name (1 second ago.)mchat (1 second ago.)c lm t (2 seconds ago.)menemensenlik (3 seconds ago.)schon (4 seconds ago.)automobile gmbh (5 seconds ago.)2 puertas (6 seconds ago.)importantfusion-person-1 (7 seconds ago.)preampjs (7 seconds ago.)ruwbouw (7 seconds ago.)關於我們 (7 seconds ago.)skipr (8 seconds ago.)terutama (9 seconds ago.)municipalities (10 seconds ago.)что приготовить на ужин (10 seconds ago.)debris (11 seconds ago.)shilpa rao (12 seconds ago.)naujos (12 seconds ago.)risks and side (14 seconds ago.)wntrze (15 seconds ago.)volvos (16 seconds ago.)behandlungsräume (16 seconds ago.)vers cro (17 seconds ago.)your brand (19 seconds ago.)contact laura (19 seconds ago.)hellipread (23 seconds ago.)body pressure relief and positioning (24 seconds ago.)  print coupon (24 seconds ago.)roadrunner password (24 seconds ago.)annapolishandcenter (24 seconds ago.)