/
Checking...American Kennel Club
Safety: High trust score
Year Founded: 1995
Global Traffic Rank: 3,921
Estimated Worth: $4,120,200
The AKC is the recognized and trusted expert in breed, health and training information for dogs.
Useful Searches
akc group
,akc
,akc cleaning equipments
,akcent
,akcaf
,akcent songs
,academy dubai
,akc sharjah
,akcp
,akc deira
,Domain summary
| Last updated | 2022-02-14 |
| Domain label | akc |
| Domain extension | org |
| Domain registered: | 1995-04-06 |
| Domain updated: | 2022-02-14 |
| Global Traffic Rank | 3,921 |
| Statvoo Rating | B |
| Trust Score | High trust score |
| Estimated worth | $4,120,200 |
| Estimated daily income | $3,815 |
| Estimated monthly income | $116,040 |
Frequently Asked Questions (FAQ)
Q: When was Akc.org registered?
A: Akc.org was registered 27 years, 1 month, 1 week, 6 days, 5 hours, 19 minutes, 46 seconds ago on Thursday, April 6, 1995.
Q: When was the WHOIS for Akc.org last updated?
A: The WHOIS entry was last updated 3 months, 5 days, 5 hours, 19 minutes, 46 seconds ago on Monday, February 14, 2022.
Q: What are Akc.org's nameservers?
A: DNS for Akc.org is provided by the following nameservers:
- ns3.akc.org
- ns1.akc.org
- ns2.akc.org
Q: Who is the registrar for the Akc.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Akc.org?
A: Akc.org ranks 3,921 globally on Alexa. Akc.org has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Akc.org each day?
A: Akc.org receives approximately 476,919 visitors and 3,815,352 page impressions per day.
Q: What IP address does Akc.org resolve to?
A: Akc.org resolves to the IPv4 address 23.185.0.4.
Q: In what country are Akc.org servers located in?
A: Akc.org has servers located in the United States.
Q: What webserver software does Akc.org use?
A: Akc.org is powered by Nginx webserver.
Q: Who hosts Akc.org?
A: Akc.org is hosted by OJSC Vimpelcom in United States.
Q: How much is Akc.org worth?
A: Akc.org has an estimated worth of $4,120,200. An average daily income of approximately $3,815, which is roughly $116,040 per month.
Akc.org Reviews
Akc.org Free SEO Report
Website Related Search Terms
Website Inpage Analysis for Akc.org
H1 Headings
1 :- For the Love of All Things Dog
H2 Headings
18 :- Top Stories
- Trending News
- Find The Right Breed
- AKC Cares
- AKC Canine Health Foundation
- AKC Canine Health Foundation
- Rescue Network
- Rescue Network
- AKC Reunite
- AKC Reunite
- AKC Humane Fund
- AKC Humane Fund
- Museum of the Dog
- Museum of the Dog
- Protecting Your Rights
- Protecting Your Rights
- Sports & Events
- Register Your Dog
H3 Headings
45 :- Breed Explorer
- Choosing The Right Breed
- Prospective Owners
- Additional Resources
- Featured
- Browse By Topic
- Tools & Quizzes
- Additional Resources
- Products
- Services
- Featured Products
- Shop The AKC Store
- GETTING STARTED IN DOG SPORTS
- Featured Events
- Browse All Dog Sports
- RESOURCES FOR DOG SPORT PARTICIPANTS
- Find a Club
- Clubs Offering:
- Clubs
- For Delegates
- Government Relations
- AKC Library & Archives
- Conformation
- Agility
- Rally
- Fast CAT
- Virtual Home Manners
- Scent Work
- Obedience
- Tracking
- Herding
- Earth Dog
- Field Trials
- Hunting
- Farm Dog Certified
- Lure Coursing
- Coursing Ability
- Coonhound
- Trick Dog
- Learn Why
- ABOUT AKC +
- Top Services +
- Top Resources +
- Get Involved +
- Favorite Things +
H4 Headings
0 :H5 Headings
0 :H6 Headings
0 :Total IFRAMEs
1 :Total Images
39 :Google Adsense
:Not Applicable
Google Analytics
:Not Applicable
Links - Internal
257:- https://www.akc.org
https://www.akc.org - Akc Event Search
https://apps.akc.org/event-search - Akc Find a Puppy
https://marketplace.akc.org/ - Akc Register Your Dog
https://www.akc.org/register/ - Akc Shop
https://shop.akc.org/ - Akc Sign In
https://www.akc.org/wp-login.php - Akc View All Breeds
https://www.akc.org/dog-breeds/ - Akc Find Your Match Answer a few simple questions and find the right dog for you
https://www.akc.org/dog-breed-selector/ - Akc Compare Breeds Compare up to 5 different breeds side by side
https://www.akc.org/compare-breeds/ - Akc Find a Puppy Browse the AKC Marketplace to find the right puppy for you
https://marketplace.akc.org/ - Akc Choose Your Breed
http://akc.org/expert-advice/lifestyle/answer-5-questions-find-right-dog/ - Akc Why Get a Dog?
http://akc.org/expert-advice/lifestyle/8-science-based-benefits-dog/ - Akc Finding a Responsible Breeder
http://akc.org/expert-advice/lifestyle/9-tips-finding-working-responsible-breeder/ - Akc Getting Started in Dog Sports
http://akc.org/expert-advice/sports/get-started-world-dog-sports-events/ - Akc All About Puppies
http://akc.org/puppies - Akc Find a Purebred Puppy
https://marketplace.akc.org/puppies - Akc Register Your Dog
https://akc.org/register/ - Akc Find a Breed Club
https://webapps.akc.org/club-search/#/ - Akc Most Popular Dog Breeds
https://www.akc.org/most-popular-breeds/ - Akc For Dog Breeders
https://www.akc.org/breeder-programs/ - Akc For Dog Owners
https://www.akc.org/dog-owners/ - Akc Lifestyle
https://www.akc.org/expert-advice/lifestyle/ - Akc 75 Ways to Be a Responsible Dog Owner
https://www.akc.org/expert-advice/lifestyle/responsible-dog-owner/ - Akc All Categories
https://www.akc.org/expert-advice/ - Akc Dog Breeding
https://www.akc.org/expert-advice/dog-breeding/ - Akc Grooming
https://www.akc.org/expert-advice/health/grooming/ - Akc Health
https://www.akc.org/expert-advice/health/ - Akc Home & Living
https://www.akc.org/expert-advice/home-living/ - Akc News
https://www.akc.org/expert-advice/news/ - Akc Nutrition
https://www.akc.org/expert-advice/nutrition/ - Akc Puppy Info
https://www.akc.org/expert-advice/puppy-information/ - Akc Dog Sports
https://www.akc.org/expert-advice/sports/ - Akc Training
https://www.akc.org/expert-advice/training/ - Akc Vet’s Corner
https://www.akc.org/expert-advice/vets-corner/ - Akc Dog Name Finder Browse our extensive library of dog names for inspiration
https://www.akc.org/dog-name-finder/ - Akc Can My Dog Eat____? Find out the best and worst foods for your dog and which to avoid
https://www.akc.org/dog-food-quiz/ - Akc AKC Magazines
http://akc.org/products-services/magazines/ - Akc Newsletters
http://akc.org/subscription/ - Akc Press Center
http://akc.org/press-center/ - Akc AKC Detection Dog Task Force
https://www.akc.org/akc-detection-dog-task-force/ - Akc AKC Canine College
https://www.caninecollege.akc.org/ - Akc Government Relations
http://akc.org/clubs-delegates/government-relations/ - Akc AKC Education
http://akc.org/public-education/ - Akc AKC Library & Archives
http://akc.org/about/archive/ - Akc Shop Dog Products
https://shop.akc.org/ - Akc Breed Specific Products
https://shop.akc.org/collections/shop-by-breed - Akc Toys & Treats
https://shop.akc.org/collections/gear-for-dogs-toys-playtime - Akc Training Products
https://shop.akc.org/collections/gear-for-dogs-training-resources-supplies - Akc Dog Gift Packs
https://shop.akc.org/collections/gear-for-dogs-gift-boxes - Akc DNA & Health Testing
http://akc.org/products-services/breeder-programs/dna/ - Akc Pedigrees
https://www.apps.akc.org/apps/store/index.cfm?view=home - Akc Breeder Reports
https://www.apps.akc.org/apps/store/?view=category&cde_category=BRDR - Akc AKC Competitor Reports
https://www.apps.akc.org/apps/store/index.cfm?view=category&cde_category=COMP - Akc Register Your Dog
https://akc.org/register - Akc Register a Purebred
https://akc.org/register/dog/ - Akc Register a Litter
http://akc.org/register/litter/ - Akc Enroll a Canine Partner
http://akc.org/register/information/canine-partners/ - Akc Registration Downloadable Forms
http://akc.org/downloadable-forms/#Registration - Akc Find a Dog
https://marketplace.akc.org/puppies - Akc AKC Rescue Network
http://akc.org/akc-rescue-network/ - Akc Breeder Referral Contacts
http://akc.org/akc-breeder-referral-contacts/ - Akc PuppyVisor Search Counselor
https://marketplace.akc.org/puppyvisor - Akc Training Services
http://akc.org/products-services/training-programs/ - Akc Canine Good Citizen (CGC)
http://akc.org/products-services/training-programs/canine-good-citizen/ - Akc GoodDog Helpline
https://www.akc.org/products-services/akc-gooddog-helpline/ - Akc Find a Training Club
https://webapps.akc.org/obedience-training-club/#/ - Akc Health & General Dog Care
http://akc.org/products-services/health-general-dog-care/ - Akc Find a Groomer
https://marketplace.akc.org/search-groomers - Akc AKC S.A.F.E. Grooming Program
http://akc.org/products-services/akc-safe-grooming-program/ - Akc AKC Veterinary Network
https://webapps.akc.org/vetnet/#/ - Akc Breeder Programs & Services
http://akc.org/products-services/breeder-programs/ - Akc Breeder Of Merit Program
http://akc.org/products-services/breeder-programs/akc-breeder-of-merit-program/ - Akc Bred With H.E.A.R.T Program
http://akc.org/products-services/breeder-programs/akc-bred-with-heart-program/ - Akc Breeder E-Z Reg
https://www.apps.akc.org/apps/ezreg/index.cfm - Akc Breeder Education
https://www.akc.org/breeder-programs/breeder-education/ - Akc Browse All Services
http://akc.org/products-services/ - https://shop.akc.org
https://shop.akc.org - Akc AKC Shop
https://shop.akc.org - Akc Intro to Dog Sports
http://akc.org/expert-advice/sports/get-started-in-dog-sports-and-events/ - Akc Canine Partners / Enroll Mixed Breed
http://akc.org/register/information/canine-partners/ - Akc Titles & Abbreviations
http://akc.org/sports/titles-and-abbreviations/ - Akc Which Sport Should You Do With Your Dog?
http://akc.org/expert-advice/lifestyle/quizzes/which-sport-should-you-do-with-your-dog/ - Akc Get Started in Dog Training
http://akc.org/products-services/training-programs/ - Akc Virtual Dog Sports & Events
http://akc.org/sports/akc-virtual-programs/ - Akc See Upcoming Events
http://akc.org/sports - Akc AKC National Tracking Invitational
http://akc.org/sports/tracking/events/akc-national-tracking-invitational/ - Akc AKC National Championship
http://akc.org/sports/conformation/national-championship/ - Akc AKC Agility Invitational
http://akc.org/sports/agility/events/akc-agility-invitational/ - Akc Obedience Classic
http://akc.org/sports/obedience/events/obedience-classic/ - Akc AKC Meet the Breeds
http://akc.org/sports/meet-the-breeds/ - Akc AKC National Obedience Championship
http://akc.org/sports/obedience/events/national-championship/ - Akc AKC Rally National Championship
http://akc.org/sports/rally/events/akc-rally-national-championship/ - Akc Conformation Dog Shows
http://akc.org/sports/conformation/ - Akc Match Shows
http://akc.org/sports/conformation/akc-match/ - Akc 4-6 Month Beginner Puppy
http://akc.org/sports/conformation/4-6-month-puppy/ - Akc Puppy of Achievement
http://akc.org/sports/conformation/puppy-of-achievement/ - Akc National Owner Handled Series
http://akc.org/sports/conformation/national-owner-handled-series/ - Akc FSS Open Show
http://akc.org/sports/conformation/fss-open-show/ - Akc Companion Sports
http://akc.org/sports/companion/ - Akc Agility
http://akc.org/sports/agility/ - Akc Obedience
http://akc.org/sports/obedience/ - Akc Rally
http://akc.org/sports/rally/ - Akc Tracking
http://akc.org/sports/tracking/ - Akc Title Recognition Program
http://akc.org/sports/title-recognition-program/ - Akc Barn Hunt
http://akc.org/sports/title-recognition-program/barn-hunt/ - Akc Disc Dog
https://www.akc.org/sports/title-recognition-program/disc-dog/ - Akc Diving Dogs
http://akc.org/sports/title-recognition-program/dock-diving/ - Akc Flyball
http://akc.org/sports/title-recognition-program/flyball/ - Akc Search & Rescue
http://akc.org/sports/title-recognition-program/search-and-rescue/ - Akc Parent Club Title Recognition
http://akc.org/sports/title-recognition-program/parent-club-title-recognition/ - Akc Performance Sports
http://akc.org/sports/beginners-guide-performance-sports/ - Akc Field Events for Hounds
http://akc.org/sports/field-events-hounds/ - Akc Coursing, CAT & FAST CAT
http://akc.org/sports/coursing/ - Akc Earthdog
http://akc.org/sports/earthdog/ - Akc Herding & Farm Dog
http://akc.org/sports/herding/ - Akc Pointing Breeds
http://akc.org/sports/pointing-breeds/ - Akc Retrievers
http://akc.org/sports/retrievers/ - Akc Scent Work
http://akc.org/sports/akc-scent-work/ - Akc Spaniels & Flushing Breeds
http://akc.org/sports/spaniels/ - Akc Sports for Juniors
http://akc.org/sports/juniors/ - Akc Junior Showmanship
http://akc.org/sports/conformation/junior-showmanship/ - Akc Juniors in Companion Events
http://akc.org/sports/juniors/junior-handlers-in-companion-sports/ - Akc Juniors in Performance Events
http://akc.org/sports/juniors/junior-handlers-in-performance-sports/ - Akc PeeWee Special Attractions
http://akc.org/sports/conformation/junior-showmanship/pee-wee-special-attraction-guidelines/ - Akc AKC Family Dog Program
https://www.akc.org/sports/akc-family-dog-program/ - Akc CGC & AKC S.T.A.R. Puppy
http://akc.org/products-services/training-programs/canine-good-citizen/ - Akc AKC Trick Dog/Virtual Competition
http://akc.org/sports/trick-dog/ - Akc AKC Therapy Dog
http://akc.org/sports/title-recognition-program/therapy-dog-program/ - Akc AKC FIT DOG
http://akc.org/sports/akc-family-dog-program/akc-fit-dog/ - Akc AKC Temperament Test
http://akc.org/akctemptest/ - Akc Event Search
https://apps.akc.org/event-search/ - Akc Downloadable Forms
http://akc.org/downloadable-forms/ - Akc Rules & Regulations
http://akc.org/rules/ - Akc Online Event Management
http://apps.akc.org/apps/eventplans/index.cfm - Akc Points & Awards
https://www.apps.akc.org//apps/store/index.cfm?view=product&cde_category=DOG&cde_product=CMPREC&external=yes/&_ga=2.169842788.471467485.1509302629-2146542360.1496667941 - Akc Judging Resource Center
http://akc.org/sports/judges-resource-center/ - Akc Judges Directory
https://www.apps.akc.org//apps/judges_directory/ - Akc Judges Education - AKC Canine College
https://www.caninecollege.akc.org/pages/judges-education - Akc Event Cancellations
http://akc.org/sports/event-cancellations/ - Akc Award Corrections
https://www.apps.akc.org/apps/awards_corrections/ - Akc AKC Contact Info for All Sports
http://akc.org/sports/contact-information-sports/ - Akc AKC Registered Handler Program
http://akc.org/sports/conformation/akc-registered-handlers/ - Akc Junior Resources
http://akc.org/sports/juniors/ - Akc Search All AKC Clubs
https://webapps.akc.org/club-search/ - Akc Find An Event
http://akc.org/sports/events/ - Akc Training Classes
https://webapps.akc.org/obedience-training-club/#/ - Akc About Club Relations
http://akc.org/clubs-delegates/clubs/about-club-relations/ - Akc Form a Club
http://akc.org/clubs-delegates/clubs/forming-a-club/ - Akc Club Bylaw Services
https://www.akc.org/clubs-delegates/clubs/forming-a-club/club-bylaw-services/ - Akc Club Development Department
https://www.akc.org/clubs-delegates/clubs/about-club-development/ - Akc Promote a Club
http://akc.org/clubs-delegates/promote/ - Akc Club Resources
http://akc.org/clubs-delegates/clubs/resources/ - Akc Delegate Portal
https://www.akc.org/clubs-delegates/delegates/delegates-portal/ - Akc Delegate Directory & Search
https://www.apps.akc.org//apps/insideAKC/delegates/delegates_search.cfm - Akc Delegate Meeting Dates
http://akc.org/clubs-delegates/delegate-meeting-dates/ - Akc Board Minutes
http://akc.org/about/minutes-reports/board-minutes/ - Akc Delegate Standing Committees
http://akc.org/clubs-delegates/delegates/standing-committees/ - Akc Perspectives Newsletter
http://akc.org/clubs-delegates/delegates/delegates-portal/perspectives/ - Akc AKC Gazette
http://akc.org/products-services/magazines/akc-gazette/ - Akc The Importance of Your AKC Delegate
http://images.akc.org/pdf/The_Importance_of_Your_AKC_Delegate_2018.pdf - Akc Legislative Alerts
http://akc.org/clubs-delegates/government-relations/legislative-alerts/ - Akc AKC PAC and Legislative Support Fund
http://akc.org/clubs-delegates/government-relations/donations/ - Akc Government Relations Department
http://akc.org/clubs-delegates/government-relations/ - Akc Overview of Collections
http://akc.org/about/archive/guide-collections/ - Akc Breed Club Archives
http://akc.org/about/archive/ - Akc How to Visit and/or Donate
http://akc.org/about/archive/faq/ - Akc Find Your Match
https://www.akc.org/dog-breed-selector/ - Akc Compare Breeds
https://www.akc.org/compare-breeds/ - Akc Dog Name Finder
https://www.akc.org/dog-name-finder/ - Akc Can My Dog Eat____?
https://www.akc.org/dog-food-quiz/ - http://akc.org/register/
http://akc.org/register/ - Akc Register Today
http://akc.org/register/ - http://akc.org/products-services/training-programs/
http://akc.org/products-services/training-programs/ - Akc Training
http://akc.org/products-services/training-programs/ - https://marketplace.akc.org/search-puppies
https://marketplace.akc.org/search-puppies - Akc Find Puppies
https://marketplace.akc.org/search-puppies - https://shop.akc.org/
https://shop.akc.org/ - Akc Shop New Products
https://shop.akc.org/ - http://akc.org/sports
http://akc.org/sports - Akc Sports & Events
http://akc.org/sports - Akc Events
https://www.akc.org/expert-advice/news/events/ - Akc Watch AKC Dog Sports on ESPN This Sunday
https://www.akc.org/expert-advice/news/how-to-watch-akc-dog-sports-espn/ - Akc Super Bowl Safety Tips for Dog Owners
https://www.akc.org/expert-advice/health/super-bowl-safety-tips-for-dog-owners/ - Akc Basic Training
https://www.akc.org/expert-advice/training/basic-training/ - Akc How to Teach Your Dog to Go Potty on Cue
https://www.akc.org/expert-advice/training/teach-your-dog-to-poop-potty-on-cue/ - Akc RECOMMENDED
http://akc.org/ - Akc Shop Valentine's Day Gifts for Your Dog
https://retrievist.akc.org/gift-guides/dog-valentines-day-gifts/ - Akc Expert Advice
https://www.akc.org/expert-advice/ - Akc Do Our Dogs Really Love Us?
https://www.akc.org/expert-advice/lifestyle/can-our-dogs-really-love-us/ - Akc What to Do if You Inherit Someone Else’s Dog
https://www.akc.org/expert-advice/home-living/inherit-someone-elses-dog/ - Akc Entlebucher Mountain Dog
https://www.akc.org/dog-breeds/entlebucher-mountain-dog/ - Akc Explore Breeds
http://akc.org/dog-breeds/ - Akc Find Your Match
http://akc.org/tools/dog-breed-selector/ - Akc Compare Breeds
http://akc.org/tools/compare-breeds/ - Akc Dog Name Finder
http://akc.org/tools/dog-name-finder/ - Akc Learn About AKC Rescue Network
https://www.akc.org/dog-breeds/rescue-network/ - Akc Learn About AKC Government Relations
http://akc.org/clubs-delegates/government-relations/ - Akc Conformation Dog shows (officially conformation) may look like beauty pageants, but they’re not. Dogs aren’t compared against each other; they’re compared against the standards of their breed.
http://akc.org/sports/conformation/ - Akc Agility An exhilarating way to exercise with your dog, Agility is a fast-paced obstacle course with tunnels, hurdles, and other challenges that your dog completes as quickly as possible.
http://akc.org/sports/agility/ - Akc Rally In Rally, you and your dog navigate a course, side-by-side, through 10-20 different exercises and, although it’s timed, it's more about proving excellent behavior and teamwork than speed.
http://akc.org/sports/rally/ - Akc Fast CAT This fast-paced event features one dog running at a time, with their speed clocked and converted to MPH. Any dog over 12 months of age that are registered or enrolled with the AKC can participate.
http://akc.org/sports/coursing/fast-cat/ - Akc Virtual Home Manners This entirely virtual program tests for the 10 necessary skills that well-mannered dogs need in the home setting! VHM gets you started on practical skills needed before your first training class.
https://www.akc.org/products-services/training-programs/canine-good-citizen/akc-family-dog-program/virtual-home-manners/ - Akc Scent Work In AKC Scent Work, the handler guides the dog through a set search area to find specific odors that the dogs have been trained to detect.
http://akc.org/sports/akc-scent-work/ - Akc Obedience Developed in the 1930s, Obedience is one of our oldest sporting events and is open to all breeds. From walking in figure eights to sitting for 1-3 minutes, dogs show off their good behavior.
http://akc.org/sports/obedience/ - Akc Tracking Your dog’s natural ability to recognize and follow a scent is on full display in AKC Tracking events.
http://akc.org/sports/tracking/ - Akc Herding In the sport of Herding, your dog uses his innate herding abilities to move sheep (or other animals) around a field.
http://akc.org/sports/herding/ - Akc Earth Dog Open to small terriers and Dachshunds, Earthdog tests are non-competitive and assess your dog’s abilities for seeking and locating prey underground.
http://akc.org/sports/earthdog/ - Akc Field Trials Since 1924, these competitions give your pointing breed a chance to show how fast he can run and his keen desire to hunt for and find game.
http://akc.org/sports/pointing-breeds/ - Akc Hunting Hunting tests are designed to test a dog's ability to work with their human hunting companion in a simulated hunting situation.
http://akc.org/sports/basset-hound-field-trials/hunting/ - Akc Farm Dog Certified The Farm Dog Certified test is a series of twelve exercises in a noncompetitive pass/fail evaluation and open to all dogs over nine months that are registered or enrolled with the AKC.
http://akc.org/sports/herding/farm-dog-certified-test/ - Akc Lure Coursing The lure will lead a pack to run as fast as they can, zig-zagging across an open field in hopes of catching it. The test is a basic performance of coursing that is non-competitive and is pass/fail.
http://akc.org/sports/coursing/lure-coursing/ - Akc Coursing Ability Most dogs have the urge to chase different objects, whether it's a ball or each other during playtime. CAT is a non-competitive, pass/fail event that harnesses their natural instinct.
http://akc.org/sports/coursing/coursing-ability-test/ - Akc Coonhound Nite Hunts require coonhounds to hunt at night with a handler and be scored on their ability to trail and tree a raccoon. It is fun to watch and the hounds enjoy doing what they were meant to do!
http://akc.org/sports/coonhound/ - Akc Trick Dog Since the 1920s and '40s when trick dogs such as Rin Tin Tin and Lassie won peoples’ hearts, trick dog training has become one of the most exciting new areas in dog training today.
http://akc.org/sports/trick-dog/about-trick-dog/ - Akc Find Events Near You
https://www.apps.akc.org/apps/event_calendar/ - Akc Register Your Dog With AKC
http://akc.org/register/ - Akc Our Mission
http://akc.org/about/mission - Akc Our History
http://akc.org/about/history/ - Akc Minutes & Reports
http://akc.org/about/minutes-reports/ - Akc Awards & Honors
http://akc.org/about/awards-and-honors/ - Akc Board of Directors & Executive Officers
http://akc.org/about/board-directors-officers/ - Akc Careers
http://akc.org/careers-at-akc/ - Akc Newsletter Subscriptions
http://akc.org/subscription/ - Akc Contact Us
https://www.apps.akc.org/apps/contact/index.cfm - Akc Find a Puppy
http://marketplace.akc.org/puppies - Akc Find a Groomer
http://marketplace.akc.org/search-groomers - Akc Purebred Registration
http://akc.org/register/ - Akc Enroll a Mixed Breed
http://akc.org/register/information/canine-partners/ - Akc GoodDog Helpline
https://www.apps.akc.org//apps/helpline/index.cfm - Akc Shop AKC Store
https://shop.akc.org/ - Akc Delegates Portal
http://akc.org/clubs-delegates/delegates/ - Akc Rules, Regulations & Policies
http://akc.org/rules/ - Akc Answer Center
https://www.apps.akc.org//apps/contact/answer_center/ - Akc Judges' Directory
https://www.apps.akc.org//apps/judges_directory/index.cfm - Akc Inspections & Compliance
http://akc.org/inspections-and-compliance/ - Akc Working It Out℠ Guide & FAQs
http://images.akc.org/pdf/Working_It_Out_Guide_and_FAQs.pdf - Akc New Website Help Guide
http://akc.org/new-website-help-guide/ - Akc Attend an Event
https://www.apps.akc.org/apps/event_calendar/ - Akc Participate in an Event
https://www.apps.akc.org/apps/events/search/ - Akc Donate
http://akc.org/donations/ - Akc Find a Club
https://webapps.akc.org/club-search/#/ - Akc Top 100 Boy Dog Names
http://akc.org/expert-advice/lifestyle/names/top-100-boy-dog-names/ - Akc Top 100 Girl Dog Names
http://akc.org/expert-advice/lifestyle/names/top-100-girl-dog-names/ - Akc Best Dog Podcast
https://www.akc.org/podcast - Akc Hypoallergenic Dog Breeds
http://akc.org/expert-advice/lifestyle/did-you-know/hypoallergenic-dog-breeds/ - Akc Dog Bite Prevention Tips
https://www.akc.org/expert-advice/training/dog-bite-prevention/ - Akc How to Potty Train a Puppy
http://akc.org/expert-advice/training/puppy-training/how-to-potty-train-a-puppy/ - Akc Why Dogs Eat Poop
http://akc.org/expert-advice/health/common-conditions/why-dogs-eat-poop/ - Akc CBD Oil for Dogs
https://www.akc.org/expert-advice/health/cbd-oil-dogs/ - Akc How to Teach Your Dog to Talk
https://www.akc.org/expert-advice/training/can-dogs-talk-one-speech-pathologist-says-yes/ - Akc Advertising
http://akc.org/advertise/ - Akc Terms of Use
http://akc.org/terms-of-use/ - Akc Privacy & Cookies
http://akc.org/privacy/ - Akc CA Privacy Rights
http://akc.org/privacy-california/ - Akc Website Info & FAQs
http://akc.org/about/site/ - Akc Linking Policy
http://akc.org/about/site/linking-policy/ - Akc Material Reproduction Policy
http://akc.org/about/site/reproduction-policy/
Links - Internal (nofollow)
0:Links - Outbound
28:- Akc AKC TV
https://akc.tv/?utm_source=akc.org&utm_medium=homepage&utm_campaign=utility_bar - Akc AKC.TV
http://akc.tv - Akc AKC.tv
http://akc.tv - Akc AKC Pet Insurance
https://www.akcpetinsurance.com/ - Akc AKC Canine Retreat
https://akccanineretreat.com/ - Akc AKC Reunite/Microchips
http://www.akcreunite.org/ - Akc AKC Weekly Winners
http://akcwinners.com/results/list-view/ - Akc The Role of an AKC Delegate
https://www.youtube.com/watch?v=m-Mp3Z9fg7s - Akc Legislative Action Center
http://cqrcengage.com/akc/lac?0 - Akc Search the Library Catalog
http://a40015.eos-intl.net/A40015/OPAC/Index.aspx - https://cli.re/akctv-app
https://cli.re/akctv-app - Akc AKC TV
https://cli.re/akctv-app - https://www.akcpetinsurance.com/?p=akchps
https://www.akcpetinsurance.com/?p=akchps - Akc Learn about Pet Insurance
https://www.akcpetinsurance.com/?p=akchps - Akc Family Dog Magazine
https://amzn.to/3eQaCzg - Akc Get tips and tricks from AKC’s experts in our lifestyle magazine for dog lovers
https://amzn.to/3eQaCzg - Akc Learn About AKC Canine Health Foundation
http://www.akcchf.org - Akc Learn About AKC Reunite
http://www.akcreunite.org/ - Akc Learn About AKC Humane Fund
https://www.akchumanefund.org/ - Akc Learn About AKC Museum of the Dog
https://museumofthedog.org/ - https://www.facebook.com/AmericanKennelClub/
https://www.facebook.com/AmericanKennelClub/ - https://twitter.com/akcdoglovers
https://twitter.com/akcdoglovers - https://www.instagram.com/americankennelclub
https://www.instagram.com/americankennelclub - https://www.tiktok.com/@americankennelclub?
https://www.tiktok.com/@americankennelclub? - https://pinterest.com/akcdoglovers/
https://pinterest.com/akcdoglovers/ - https://www.youtube.com/user/AmericanKennelClub
https://www.youtube.com/user/AmericanKennelClub - Akc AKC Humane Fund
https://www.akchumanefund.org/ - Akc Watch Dog Shows
http://AKC.tv
Links - Outbound (nofollow)
0:Keyword Cloud for Akc.org
productssearchmatchaustralianbull terriercattlewater spanielakc rescuejuniorcanine collegedelegatesconformation dog showsentlebucher mountain dogresponsible dog ownershipgroupschnauzerfastcaninedog australianreunite akcakctvdownloadable formsgermanresourcesbulldogtopyour dog findchampionshiprightgreatvizslaprotecting yournorwegianspringer spanieltestnewsnamedogakc nationaleattrainingnewamericanmountainyour rightsitsfind a clubterrier americanotherakc reunitetheyrightsmanchesteryouclub clubwelsh corgiamp archivesservicespyreneanfamilysports ampminutesdepartmentshepherdeventswelshkaicenternewsletterampdog name finderregisterhumanelifestyleownerspetshouldlapphundmost popular dogprogramsmost popularrelationstvregisterednationalresponsiblestarted in dogbassetdownloadable forms rulespopularpuppy registerdog trainingakc humane fundsupportbestperformancepointingdoall dogschowakc canine healthagilitycontactpointersincekelpierussianpress centercompanionyoureventakc rescue networkyour matchcorgidownloadabledog finddelegateakc library ampmostleopardshop akcnoncompetitivedogs bestdog sportsakctv akcentlebucher mountainwatchhoundbordergreyhoundspanieldog namegriffonfox terrierrescue networknational championshipmountain doganswerdogswirehaired pointermastiffbreedingbasset griffon vendenreportshandlerourtrickmanchester terriervendenworkingspitzslovenskycansetter irishcocker spanielfind your matchgriffon vendenminiaturebreedresponsible dogconformationtodayeducation akc canineakcopenfamily dogmuseumspanishnetwork akctreeingregister yoursports amp eventsinformationpressvirtualpinscherfrenchlibrary amp archivesdirectorykenownershipscottishobedienceyour dogsfarm dogswedishifgovernment relationsfarmakc libraryreunitecareright breedlargestdifferentfoundationchinesetitleeducation akcakctv akc magazineslearn about akcsetterfind the rightshowname findermagazinesgovernment relations departmentexpert advicecompare breedspopular dogallclubsmixedhuntreports akcworkmanagementhomeexpertscentarchivesnetworkhumane fundrulesfindformscattle dog australianpuppylibrary ampdog breedfeaturedcollegecockerconformation dogsportssportfoxhoundretrieverwhyscent workshepherd dogjudgesadvicetestswater dogakc canine collegerelations departmentadditional resourcesirishall dogamp servicespointer germanfinnishrescueamp eventstipsjuniorsprogramcoursingwhichwhitetibetanblackcatprovidingabilityakc delegateforms rulespassfailnameshuntingcattle dogakc tvfinderproducts shophealth foundationcollieitalianopromotefundinvitationalspringerquestionswirehairedbreedsakc canineakc magazinesbreed clublegislativerecognitionbelgianregister your dogchampionship akcgroomingportuguese podengopoodlebasset griffonyour dogenrolltoyherdingdonatestaffordshiredog ownershipfieldpodengopurebreddog showsgetting startedevent searchclubfind yourdog namessmallakc humanemixed breedrussellterrier standardawardscoonhoundshowshairlessromanianboardridgebackfind a puppyeducationalaskanusentlebucherregistrationbulltheirstartedregulationspuppy register yourcanine health foundationbrowsepolicyprotectinglibrarycanine healthshoplearncompareowneradditionalsheepdogbraquewatertrackinginfoportuguesestandardall breedsonerussell terrierresources findpuppieshealthbreederpopular dog breedsselectgetenglishbreeds findprotecting your rightsgovernmenttitle recognitiondog breedsrallyspaniel englishjapanesebrowse allterrierdedicateddog ownersfoxportalakc reunite akcmorethroughgetting
Longtail Keyword Density for Akc.org
Who hosts Akc.org?
Akc.org Hosting Provider Information
| Hosted IP Address: | 23.185.0.4 |
| Hosted Hostname: | 23.185.0.4 |
| Service Provider: | OJSC Vimpelcom |
| Hosted Country: |  US |
| Location Latitude: | 37.751 |
| Location Longitude: | -97.822 |
| Webserver Software: | nginx |
Is "OJSC Vimpelcom" in the Top 10 Hosting Companies?
Name
Percentage
Unknown
21.9161%
GOOGLE
14.0532%
AS-26496-GO-DADDY-COM-LLC
3.4879%
NAMECHEAP-NET
3.1470%
AMAZON-AES
2.2136%
GoDaddy.com, LLC
2.0287%
UNIFIEDLAYER-AS-1
1.9645%
Fara Negar Pardaz Khuzestan
1.6143%
CONFLUENCE-NETWORK-INC
1.4660%
1&1 Internet AG
1.3358%
OJSC Vimpelcom
0.0160%
HTTP Header Analysis for Akc.org
| Http-Version: | 1.1 |
| Status-Code: | 200 |
| Status: | 200 OK |
| Connection: | keep-alive |
| Content-Length: | 72434 |
| Cache-Control: | public, max-age=600 |
| Content-Encoding: | gzip |
| Content-Type: | text/html; charset=UTF-8 |
| Link: | |
| Server: | nginx |
| Strict-Transport-Security: | max-age=300 |
| Traceparent: | 00-0be6063e1f6e45389532bcadf19421d5-5b484b9aeab053bf-00 |
| X-Cloud-Trace-Context: | 0be6063e1f6e45389532bcadf19421d5/6577590384509080511;o=0 |
| X-Pantheon-Styx-Hostname: | styx-fe4-a-6cdc754b6c-t66m6 |
| X-Styx-Req-Id: | 841e631f-8d33-11ec-bba2-ca51e363301b |
| Date: | Mon, 14 Feb 2022 01:15:48 GMT |
| X-Served-By: | cache-mdw17330-MDW, cache-lcy19221-LCY |
| X-Cache: | HIT, MISS |
| X-Cache-Hits: | 1, 0 |
| X-Timer: | S1644801348.429810,VS0,VE93 |
| Vary: | Accept-Encoding, Cookie, Cookie |
| Age: | 52 |
| Accept-Ranges: | bytes |
| Via: | 1.1 varnish, 1.1 varnish |
Akc.org Domain Nameserver Information
| Host | IP Address | Country |
|---|---|---|
| ns3.akc.org | 40.143.46.130 | United States |
| ns1.akc.org | 74.203.101.131 | United States |
| ns2.akc.org | 74.203.101.132 | United States |
Need to find out who hosts Akc.org?
Domain Registration (WhoIs) information for Akc.org
Domain Name: AKC.ORG
Registry Domain ID: D3079776-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.whois.godaddy.com
Updated Date: 2021-05-28T18:30:40Z
Creation Date: 1995-06-04T04:00:00Z
Registry Expiry Date: 2029-06-03T04:00:00Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: Domains By Proxy, LLC
Registrant State/Province: Arizona
Registrant Country: US
Name Server: NS1.AKC.ORG
Name Server: NS2.AKC.ORG
Name Server: NS3.AKC.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2022-02-14T01:14:50Z
Websites with Similar Names
Akc-bd.com
AHMED KHAN CO. | Leading Chartered Accountant firm of Bangladesh
AHMED KHAN CO. | Leading Chartered Accountant firm of Bangladesh
Akc-edu.xyz
???????????
???????????
Akc-europe.com
Site not found
Site not found
Akc-golf.com
秋田北クラシックゴルフ倶楽部
秋田北クラシックゴルフ倶楽部
Akc-gov.xyz
VOTO?????
VOTO?????
Recently Updated Websites
Liontedcruz.com (10 seconds ago.), Thealtarofthekingdomofgod.com (12 seconds ago.), Usawoalordfairfax.org (13 seconds ago.), Vipsmoketobacco.com (16 seconds ago.), R2j-group.com (17 seconds ago.), Socds.com (19 seconds ago.), A1hr.in (23 seconds ago.), Gundogdumotorsaksaray.com (25 seconds ago.), Binz-ferienwohnungen-ruegen.de (31 seconds ago.), Daddoadvice.com (32 seconds ago.), Tedrogersresearch.ca (34 seconds ago.), Swedish.hospital (39 seconds ago.), 3rbc.net (51 seconds ago.), Kellyharman.com (53 seconds ago.), Visoroptics.com (57 seconds ago.), Alacarte.tv (1 minute 5 seconds ago.), Plytek.fun (1 minute 7 seconds ago.), Sabrinalieb.com (1 minute 13 seconds ago.), Topbeton.su (1 minute 16 seconds ago.), Goldenhillspestcontrol.com (1 minute 20 seconds ago.), Devnt.com (1 minute 21 seconds ago.), Huile-penrite.fr (1 minute 22 seconds ago.), Kanxiaoshuo.net (1 minute 30 seconds ago.), Grumpypals.com (1 minute 31 seconds ago.), Costasumba.com (1 minute 37 seconds ago.), Rajoyideasgratis.blogspot.com.es (1 minute 38 seconds ago.), Shipwego.com (1 minute 45 seconds ago.), Rainews.it (1 minute 47 seconds ago.), Drinkforlifes.com (1 minute 48 seconds ago.), Thelastest.com (1 minute 49 seconds ago.),
Recently Searched Keywords
that girl lay lay dad name (1 second ago.), mchat (1 second ago.), c lm t (2 seconds ago.), menemensenlik (3 seconds ago.), schon (4 seconds ago.), automobile gmbh (5 seconds ago.), 2 puertas (6 seconds ago.), importantfusion-person-1 (7 seconds ago.), preampjs (7 seconds ago.), ruwbouw (7 seconds ago.), 關於我們 (7 seconds ago.), skipr (8 seconds ago.), terutama (9 seconds ago.), municipalities (10 seconds ago.), что приготовить на ужин (10 seconds ago.), debris (11 seconds ago.), shilpa rao (12 seconds ago.), naujos (12 seconds ago.), risks and side (14 seconds ago.), wntrze (15 seconds ago.), volvos (16 seconds ago.), behandlungsräume (16 seconds ago.), vers cro (17 seconds ago.), your brand (19 seconds ago.), contact laura (19 seconds ago.), hellipread (23 seconds ago.), body pressure relief and positioning (24 seconds ago.), print coupon (24 seconds ago.), roadrunner password (24 seconds ago.), annapolishandcenter (24 seconds ago.),
