Aktienjournal.de  |  Aktienjournal.de - Aktien, Kurse, Wirtschaft, Finanzen, Karriere, Lexikon und mehr...
Low trust score  | 
Das Aktienjournal mit aktuellen Informationen zu Aktien, DAX, Kursen, Lexikon und vieles mehr...

Aktienjournal.de Website Information

Aktienjournal.de has a Low Trust Score, a Statvoo Rank of I, an Alexa Rank of 8,448,202, a Majestic Rank of 0, a Domain Authority of 20% and is not listed in DMOZ.

Aktienjournal.de is hosted by myLoc managed IT AG in Germany.
Aktienjournal.de has an IP Address of 91.242.212.15 and a hostname of 5BF2D40F.mediaventures.de.

The domain aktienjournal.de was registered 201 decades 8 years 9 months ago by , it was last modified 7 years 8 months 2 weeks ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for aktienjournal.de

Full Whois Lookup for Aktienjournal.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: aktienjournal.de
Nserver: hulk.work.de
Nserver: ns.work.de
Status: connect
Changed: 2017-03-10T09:21:14+01:00

[Tech-C]
Type: PERSON
Name: Jan Diegelmann
Organisation: [email protected] Internet Informationssystem GmbH
Address: Wandalenweg 5
PostalCode: 20097
City: Hamburg
CountryCode: DE
Phone: +49 40 2388090
Fax: +49 40 23880929
Email: Login to show email
2011-10-26T10:53:03+02:00

[Zone-C]
Type: PERSON
Name: Jan Diegelmann
Organisation: [email protected] Internet Informationssystem GmbH
Address: Wandalenweg 5
PostalCode: 20097
City: Hamburg
CountryCode: DE
Phone: +49 40 2388090
Fax: +49 40 23880929
Email: Login to show email
2011-10-26T10:53:03+02:00

Who hosts Aktienjournal.de?

Aktienjournal.de Web Server Information

Hosted IP Address:91.242.212.15
Hosted Hostname:5BF2D40F.mediaventures.de
Service Provider:myLoc managed IT AG
Hosted Country:GermanyDE
Location Latitude:51
Location Longitude:9
Webserver Software:Not Applicable

HTTP Header Analysis for Aktienjournal.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 24 Oct 2015 04:20:16 GMT
Server: Apache/2.2.15 (CentOS)
Last-Modified: Sat, 24 Oct 2015 00:03:48 GMT
Accept-Ranges: bytes
Content-Length: 7669
Cache-Control: max-age=3, must-revalidate
Expires: Sat, 24 Oct 2015 04:20:19 GMT
Vary: Accept-Encoding,Cookie
Connection: close
Content-Type: text/html; charset=UTF-8
Content-Encoding: gzip


Need to find out who hosts Aktienjournal.de?

Aktienjournal.de Free SEO Report

Website Inpage Analysis for Aktienjournal.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Aktienjournal.de

neuede0005552004 wknbelsst thyssenkisin de0005552004 wkndernach1thyssenkrupp isin de0007500001agdie aktiedasanalyser 8211 dieeinstufung frdie einstufung frdie einstufungeurokulmbach wwwaktiencheckdefr thyssenkrupp isinde0007500001 wkn 750000fr thyssenkruppeinede0005552004tickersymbolseptember 2017isin de0007500001 wkneinstufung8211 dierckbelsstweiterlesen 15de00075000014isin de0007500001zumpostseptemberotcsymbolweiterlesenhathat die einstufungaufwkn 750000nasdaq3hannoverseptember 2017 0isinisin de0005552004hannover rckanalyser5thyssenkrupp isinwkntrue15 september 2017deutschekulmbach15 septembereinemdpaafx analyser 8211deutsche postanalysendpaafxthyssenkruppnewsde0007500001 wkn2017 0 kommentareanalyser 8211mitkurszielwkn 555200daxmit einemaktiewwwaktiencheckdenewimfrthyssenkdpaafx analyservonvar00 kommentarenasdaq otcsymbol2017 0fielmannde0005552004 wkn 555200diehat dieweiterlesen 15 septembereinstufung fr thyssenkrupp26kommentare

Longtail Keyword Density for Aktienjournal.de

KeywordsOccurences
september 2017 08
2017 0 kommentare8
de0007500001 wkn 7500006
isin de0007500001 wkn6
thyssenkrupp isin de00075000016
dpa-afx analyser 82115
analyser 8211 die4
15 september 20174
einstufung fr thyssenkrupp3
fr thyssenkrupp isin3
die einstufung fr3
weiterlesen 15 september3
isin de0005552004 wkn3
de0005552004 wkn 5552003
hat die einstufung3
september 20178
0 kommentare8
2017 08
wkn 7500006
isin de00075000016
de0007500001 wkn6
thyssenkrupp isin6
dpa-afx analyser5
analyser 82115
deutsche post5
8211 die4
15 september4
nasdaq otc-symbol4
die aktie4
hat die3
die einstufung3
fr thyssenkrupp3
hannover rck3
weiterlesen 153
einstufung fr3
isin de00055520043
kulmbach wwwaktiencheckde3
wkn 5552003
belsst thyssenk3
de0005552004 wkn3
mit einem3
die22
der18
fr12
auf11
thyssenkrupp11
mit9
isin9
september9
von9
wkn9
08
kommentare8
weiterlesen8
18
var7
27
36
aktie6
de00075000016
post6
das6
hat5
deutsche5
analyser5
einem5
dpa-afx5
new5
44
belsst4
nach4
nasdaq4
ticker-symbol4
wwwaktiencheckde4
eine4
otc-symbol4
ag4
im4
einstufung3
analysen3
fielmann3
hannover3
53
zum3
rck3
euro3
true3
63
kulmbach3
thyssenk3
de00055520043
news3
neue3
dax3
kursziel3

What are the nameservers for aktienjournal.de?

Aktienjournal.de Domain Nameserver Information

HostIP AddressCountry
hulk.work.de 213.178.67.30Germany Germany
ns.work.de 212.12.32.174Germany Germany

Aktienjournal.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Aktienjournal.de is a scam?