Alditalk.de

Website Thumbnail
Checking...
Prepaid surfen, telefonieren, & günstige Smartphones | ALDI TALK

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 117,551
Estimated Worth: $106,800
Last updated:2020-10-13


Domain summary

Domain label
alditalk
Domain extension
de
Global Traffic Rank
117,551
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$106,800
Estimated daily income
$178
Estimated monthly income
$5,414

Rank summary

How is alditalk.de ranked relative to other sites:

Percentage of visits to alditalk.de from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Alditalk.de registered?
A: Alditalk.de was registered 1 month, 2 weeks, 2 days, 22 hours, 46 minutes, 29 seconds ago on Tuesday, October 13, 2020.
Q: When was the WHOIS for Alditalk.de last updated?
A: The WHOIS entry was last updated 2 years, 4 months, 1 week, 4 days, 22 hours, 46 minutes, 29 seconds ago on Wednesday, July 18, 2018.
Q: What are Alditalk.de's nameservers?
A: DNS for Alditalk.de is provided by the following nameservers:
  • ns.domainnetwork.se
  • ns2.domainnetwork.se
  • ns3.domainnetwork.com
Q: Who is the registrar for the Alditalk.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Alditalk.de?
A: Alditalk.de ranks 117,551 globally on Alexa. Alditalk.de has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Alditalk.de each day?
A: Alditalk.de receives approximately 14,224 visitors and 71,120 page impressions per day.
Q: What IP address does Alditalk.de resolve to?
A: Alditalk.de resolves to the IPv4 address 62.180.131.138.
Q: In what country are Alditalk.de servers located in?
A: Alditalk.de has servers located in the Germany.
Q: What webserver software does Alditalk.de use?
A: Alditalk.de is powered by Apache webserver.
Q: Who hosts Alditalk.de?
A: Alditalk.de is hosted by British Telecommunications plc in North Rhine-westphalia, Essen, Germany, 45307.
Q: How much is Alditalk.de worth?
A: Alditalk.de has an estimated worth of $106,800. An average daily income of approximately $178, which is roughly $5,414 per month.

Alditalk.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Alditalk.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Alditalk.de

H1 Headings

0 :

H2 Headings

13 :
  1. ALDI TALK - genenalüberholte iPhones
  2. Paket S1,2
  3. Paket M1,3
  4. Paket L1,4
  5. Internet-Flatrate S1,5
  6. Internet-Flatrate M1,6
  7. Internet-Flatrate L1,7
  8. Internet-Flatrate XL1,8
  9. Musik-Paket M1,11
  10. Musik-Paket L1,12
  11. Top-Smartphones zum Top-Preis
  12. ALDI TALK - Alle Vorteile auf einen Blick
  13. Smartphones bis 100 €

H3 Headings

6 :
  1. Geben Sie Ihren Suchbegriff ein
  2. Die meist gestellten Fragen zu Tarifen, SIM Karte und Registrierung
  3. Typisch ALDI TALK: flexibel von Monat zu Monat
  4. Prepaid: Surfen, Telefonieren und Musik streamen
  5. Für Handybesitzer: günstiges Telefonieren im Paketpreis
  6. Mehrfach ausgezeichnet! ALDI TALK überzeugt durch starke Leistung.

H4 Headings

6 :
  1. Xiaomi Redmi 9C
  2. Samsung Galaxy A20e
  3. Samsung Galaxy A20s
  4. Nokia 1.3
  5. Alcatel 1V
  6. Motorola moto e5

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

42 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

127:
  1. Alditalk SIM aktivieren
    http://alditalk.de/simcard/register
  2. Alditalk 0 Warenkorb
    http://alditalk.de/cart
  3. Alditalk Prepaid Starter-Set
    https://www.alditalk.de/basis-prepaid-tarif-sim-karte
  4. Alditalk Basis-Prepaid-Tarif
    https://www.alditalk.de/basis-prepaid-tarif-sim-karte
  5. Alditalk Kombi-Pakete
    http://alditalk.de/smartphone-tarif-optionen-prepaid
  6. Alditalk Paket S
    https://www.alditalk.de/paket-s
  7. Alditalk Paket M
    https://www.alditalk.de/paket-m
  8. Alditalk Paket L
    https://www.alditalk.de/paket-l
  9. Alditalk Musik-Streaming
    http://alditalk.de/musik-flat
  10. Alditalk Musik-Paket M
    https://www.alditalk.de/musik-paket-m
  11. Alditalk Musik-Paket L
    https://www.alditalk.de/musik-paket-l
  12. Alditalk Internet-Flatrates
    http://alditalk.de/prepaid-internet-flat-tarif-optionen
  13. Alditalk Internet-Flatrate S
    https://www.alditalk.de/internet-flat-s
  14. Alditalk Internet-Flatrate M
    https://www.alditalk.de/internet-flat-m
  15. Alditalk Internet-Flatrate L
    https://www.alditalk.de/internet-flat-l
  16. Alditalk Internet-Flatrate XL
    https://www.alditalk.de/internet-flat-xl
  17. Alditalk Reise-Pakete
    https://www.alditalk.de/reisepakete
  18. Alditalk Community-Flatrate
    https://www.alditalk.de/community-flatrate
  19. Alditalk Zusätzliches High-Speed-Volumen
    https://www.alditalk.de/high-speed-datenvolumen-aufladen
  20. Alditalk Jahrespaket
    https://www.alditalk.de/jahrespaket
  21. Alditalk ALDI TALK Hotspot
    https://www.alditalk.de/hotspot
  22. Alditalk  
    https://www.alditalk.de/c/samsung-smartphones
  23. Alditalk  
    https://www.alditalk.de/c/apple-smartphones
  24. Alditalk  
    https://www.alditalk.de/c/nokia-smartphones
  25. Alditalk  
    https://www.alditalk.de/c/sony-smartphones
  26. Alditalk  
    https://www.alditalk.de/c/xiaomi-smartphones
  27. Alditalk Smartphones
    https://www.alditalk.de/c/smartphones
  28. Alditalk Mobiltelefone
    https://www.alditalk.de/c/mobiltelefone
  29. Alditalk Tablets
    https://www.alditalk.de/c/tablets
  30. Alditalk Smarte Produkte
    https://www.alditalk.de/c/zubehoer?q=%3Arelevance%3Acategory%3Alautsprecher&text=
  31. Alditalk Fitness
    https://www.alditalk.de/c/fitness
  32. Alditalk Zubehör
    https://www.alditalk.de/c/zubehoer
  33. Alditalk Starter-Set registrieren und aktivieren
    https://www.alditalk.de/registrieren
  34. Alditalk Rufnummer mitnehmen
    https://www.alditalk.de/rufnummernmitnahme
  35. Alditalk Tarif verwalten
    https://www.alditalk.de/tarifverwaltung
  36. Alditalk Guthaben aufladen
    https://www.alditalk.de/guthaben-aufladen
  37. Alditalk Tarifoption per Bankkonto bezahlen
    http://www.alditalk.de/bezahlung-per-bankkonto
  38. Alditalk Rund um die SIM-Karte
    https://www.alditalk.de/sim-karte-service
  39. Alditalk ALDI TALK App
    http://alditalk.de/tarif/app
  40. Alditalk FAQ
    http://alditalk.de/faq
  41. Alditalk Downloads & Formulare
    http://alditalk.de/downloads-formulare
  42. Alditalk Kontakt
    http://alditalk.de/kontakt
  43. Alditalk Fitness
    https://www.alditalk.de/fitness
  44. Alditalk Smarte Lautsprecher
    https://www.alditalk.de/c/lautsprecher
  45. http://alditalk.de/paket-m
    http://alditalk.de/paket-m
  46. Alditalk ALDI TALK - genenalüberholte iPhones
    http://alditalk.de/iphones
  47. https://www.alditalk.de/paket-m
    https://www.alditalk.de/paket-m
  48. http://alditalk.de/iphones
    http://alditalk.de/iphones
  49. Alditalk Produktdetails zum Paket S
    https://www.alditalk.de/paket-s
  50. Alditalk Produktinformationsblatt
    https://www.alditalk.de/produktinformationsblatt
  51. Alditalk Paket S wählen
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23009021&combiProductLink=/cart
  52. https://www.alditalk.de/addToCartAndRedirectToLink?code=23009021&combiProductLink=/p/30030116
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23009021&combiProductLink=/p/30030116
  53. Alditalk z.B. Alcatel 1s (2020) ab 15,07 € / MonatLaufzeit 6 Monate**+ Starter-Set gratis
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23009021&combiProductLink=/p/30030116
  54. Alditalk Alcatel 1s wählen
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23009021&combiProductLink=/p/30030116
  55. Alditalk anderes Smartphone wählen
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23009021&combiProductLink=/smartphones-paket-s
  56. Alditalk Produktdetails zum Paket M
    https://www.alditalk.de/paket-m
  57. Alditalk Paket M wählen
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23015021&combiProductLink=/cart
  58. https://www.alditalk.de/addToCartAndRedirectToLink?code=23015021&combiProductLink=/p/30028958
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23015021&combiProductLink=/p/30028958
  59. Alditalk z.B. ZTE Blade 10 ab 9,59 € / MonatLaufzeit 12 Monate**+ Starter-Set gratis
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23015021&combiProductLink=/p/30028958
  60. Alditalk Blade 10 wählen
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23015021&combiProductLink=/p/30028958
  61. Alditalk anderes Smartphone wählen
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23015021&combiProductLink=/smartphones-paket-m
  62. Alditalk Produktdetails zum Paket L
    https://www.alditalk.de/paket-l
  63. Alditalk Paket L wählen
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23016021&combiProductLink=/cart
  64. https://www.alditalk.de/addToCartAndRedirectToLink?code=23016021&combiProductLink=/p/30029451
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23016021&combiProductLink=/p/30029451
  65. Alditalk z.B. iPhone SE 2020 ab 22,98 € / MonatLaufzeit 24 Monate**+ Starter-Set gratis
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23016021&combiProductLink=/p/30029451
  66. Alditalk iPhone SE wählen
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23016021&combiProductLink=/p/30029451
  67. Alditalk anderes Smartphone
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23016021&combiProductLink=/smartphones-paket-l
  68. Alditalk Produktdetails
    https://www.alditalk.de/internet-flat-s
  69. Alditalk Internet-Flatrate S wählen
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23006021&combiProductLink=/cart
  70. https://www.alditalk.de/addToCartAndRedirectToLink?code=23006021&combiProductLink=/p/30029335
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23006021&combiProductLink=/p/30029335
  71. Alditalk z.B. Nokia 1.3 ab 9,26 € / MonatLaufzeit 12 Monate**+ Starter-Set gratis
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23006021&combiProductLink=/p/30029335
  72. Alditalk Nokia 1.3 wählen
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23016021&combiProductLink=/p/30029335
  73. Alditalk anderes Smartphone
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23016021&combiProductLink=/smartphones-internet-flatrate-s
  74. Alditalk Produktdetails
    https://www.alditalk.de/internet-flat-m
  75. Alditalk Internet-Flatrate M wählen
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23010021&combiProductLink=/cart
  76. https://www.alditalk.de/addToCartAndRedirectToLink?code=23015021&combiProductLink=/p/30029902
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23015021&combiProductLink=/p/30029902
  77. Alditalk z.B. Samsung Galaxy A21s ab 9,38 € / MonatLaufzeit 24 Monate**+ Starter-Set gratis
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23015021&combiProductLink=/p/30029902
  78. Alditalk Galaxy A21s wählen
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23015021&combiProductLink=/p/30029414
  79. Alditalk anderes Smartphone
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23015021&combiProductLink=/smartphones-internet-flatrate-m
  80. Alditalk Produktdetails
    https://www.alditalk.de/internet-flat-l
  81. Alditalk Internet-Flatrate L wählen
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23002021&combiProductLink=/cart
  82. https://www.alditalk.de/addToCartAndRedirectToLink?code=30027099&combiProductLink=/p/30030214
    https://www.alditalk.de/addToCartAndRedirectToLink?code=30027099&combiProductLink=/p/30030214
  83. Alditalk z.B. Motorola Edge ab 26,04 € / MonatLaufzeit 24 Monate**+ Starter-Set gratis
    https://www.alditalk.de/addToCartAndRedirectToLink?code=30027099&combiProductLink=/p/30030214
  84. Alditalk Motorola Edge wählen
    https://www.alditalk.de/addToCartAndRedirectToLink?code=30027099&combiProductLink=/p/30030214
  85. Alditalk anderes Smartphone
    https://www.alditalk.de/addToCartAndRedirectToLink?code=30027099&combiProductLink=/smartphones-internet-flatrate-l
  86. Alditalk Produktdetails
    https://www.alditalk.de/internet-flat-xl
  87. Alditalk Mehr Details
    https://www.alditalk.de/internet-flat-xl
  88. Alditalk Produktdetails zum Musik-Paket M
    https://www.alditalk.de/musik-paket-m
  89. Alditalk Musik-Paket M wählen
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23018021&combiProductLink=/cart
  90. https://www.alditalk.de/addToCartAndRedirectToLink?code=23018021&combiProductLink=/p/30029765
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23018021&combiProductLink=/p/30029765
  91. Alditalk z.B. moto g Pro ab 14,67 € / MonatLaufzeit 12 Monate**+ Starter-Set gratis
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23018021&combiProductLink=/p/30029765
  92. Alditalk moto g Pro wählen
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23018021&combiProductLink=/p/30029765
  93. Alditalk anderes Smartphone wählen
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23018021&combiProductLink=/smartphones-musik-paket-m
  94. Alditalk Produktdetails zum Musik-Paket L
    https://www.alditalk.de/musik-paket-l
  95. Alditalk Musik-Paket L wählen
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23019021&combiProductLink=/cart
  96. https://www.alditalk.de/addToCartAndRedirectToLink?code=23019021&combiProductLink=/p/30030214
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23019021&combiProductLink=/p/30030214
  97. Alditalk z.B. Motorola Edge ab 26,04 € / MonatLaufzeit 24 Monate**+ Starter-Set gratis
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23019021&combiProductLink=/p/30030214
  98. Alditalk Motorola Edge wählen
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23019021&combiProductLink=/p/30030214
  99. Alditalk anderes Smartphone wählen
    https://www.alditalk.de/addToCartAndRedirectToLink?code=23019021&combiProductLink=/smartphones-musik-paket-l
  100. Alditalk   Xiaomi Redmi 9C 118,84 €
    http://alditalk.de/p/30030608
  101. Alditalk   Samsung Galaxy A20e 139,84 €
    http://alditalk.de/p/30030612
  102. Alditalk   Samsung Galaxy A20s 154,23 €
    http://alditalk.de/p/30030527
  103. Alditalk Pakete S
    https://www.alditalk.de/paket-s
  104. Alditalk M
    https://www.alditalk.de/paket-m
  105. Alditalk Musik Paket M
    https://www.alditalk.de/musik-paket-m
  106. Alditalk Musik Paket L
    https://www.alditalk.de/musik-paket-l
  107. Alditalk   Nokia 1.3 87,29 €
    http://alditalk.de/p/30029335
  108. Alditalk   Alcatel 1V 67,89 € 49,94 €
    http://alditalk.de/p/30029310
  109. Alditalk   Motorola moto e5 77,59 € 67,89 €
    http://alditalk.de/p/30026325
  110. http://alditalk.de/testergebnisse
    http://alditalk.de/testergebnisse
  111. Alditalk Verbraucherinformationen
    https://www.alditalk.de/verbraucherinformationen
  112. Alditalk Datenschutz (www.alditalk.de)
    https://www.alditalk.de/datenschutz
  113. Alditalk Nutzungsrichtlinien
    https://www.alditalk.de/nutzungsrichtlinien
  114. Alditalk Impressum
    https://www.alditalk.de/impressum
  115. Alditalk ALDI TALK Starter Set
    https://www.alditalk.de/basis-prepaid-tarif-sim-karte
  116. Alditalk Klassische Mobiltelefone
    https://www.alditalk.de/c/mobiltelefone
  117. Alditalk Garantiebedingungen
    https://www.alditalk.de/tarifverwaltung
  118. Alditalk Wichtige Hinweise zur Rückgabe
    http://alditalk.de/rueckgabe
  119. Alditalk Elektronik-Altprodukt Rücknahme
    http://alditalk.de/altprodukt-ruecknahme
  120. Alditalk Datenschutz (Mobilfunk)
    https://www.alditalk.de/datenschutz
  121. Alditalk Downloads & Formulare
    https://www.alditalk.de/downloads-formulare
  122. Alditalk SIM-Registrierung / Aktivierung
    https://www.alditalk.de/registrieren
  123. Alditalk Rufnummer mitnehmen
    http://alditalk.de/rufnummernmitnahme
  124. Alditalk Guthaben aufladen
    http://alditalk.de/guthaben-aufladen
  125. Alditalk Bezahlung per Bankkonto
    http://alditalk.de/bezahlung-per-bankkonto
  126. Alditalk Tarifverwaltung / Mein ALDI TALK
    http://alditalk.de/tarifverwaltung
  127. Alditalk www.alditalk.de
    http://alditalk.de/

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Alditalk.de

top 2pxcontainer uspboxlistjew1 msflexpositive 1paket smarginleft 1666667screen and minwidth30emutiliconbeforeutiliconmusicbeforecontent important80px mediaminwidth30em footer linkssuedzum aldi talkpaddingnavservicelogowrapper logologonameltenbsp19backgroundcolorutiliconafterutiliconpaketphoneafterslidernavcontainer slidernav slickdots0 msflexorder 17pxwirdinklusivefff textdecorationleft media screen0 1rem10pxmargin 0 auto3333333 maxwidth 33333334166667 maxwidth 41666679375rem125rem border solid6px 10px11 msflexordernoneauf wunsch mitzum paketbutton2px 9pxflex webkitboxorient horizontaltdablauf35px3 msflexorder 23px 10px rgba0webkitboxalign centerdisplay flex mediatranslate3d0msflexdirection column flexdirectionwebkitbox displayfooterborderdesktoptop leftgelten die preisepadding 0pxmonate startersetheight 0productslider slickslidesimboxnavservicesimanchorproductteaserimagewebkitboxordinalgroup 10 msflexorderrowsubmenulistbuttonlastchildabsolute top3s ease transitiontranslate0 24pxminwidth48emablauf geltenbtnhoverwebkitboxordinalgroup 7 msflexorderverfallen am laufzeitendewerdenright 0 bottom22pxposition fixedrelative2 orderlibeforebackgroundrepeateb5a0c backgroundmaxwidth 4166667maxwidth 500 webkitboxshadowaustd thlife musik poweredslidernavcontainer slidernavcolor fffimportantutiliconbeforeutiliconpaketphonebeforecenter padding0 order 044position absolute rightunbegrenzte gesprchespan colortooltip pricebox100 media4 wochen enthltverticalalign4media screenautonokiapriceboxbig currentpricemonthlyflexbasis 0 webkitboxflexaldi talk paket60pxgeschwindigkeit bismarginleft 833333formatsvg fontface fontfamilym whlen auf9166667 mediaall 6sfooterpayment5 ordermarginbottom 20pximportanttd th fontsizeverfallen amfontstyle normal fontweighteb5a0c bordercolor eb5a0cimg width 100laufzeit150ms ease transitionul displaymedia minwidth768pxablauf gelten dietextdecoration none lineheightlaufzeit 7 tagesmartphone internetflatrateoverflow000nbsp nbsp0pxtelefonierenenthlt euweite1125remmsflexorder 12boxsizing borderboxeinmaligihrenfrom5f77bf to001e78 backgroundende des jewli fontsizezumposition relative zindexmusik poweredbtn fontsizeofferteaserlistutiliconbeforeutiliconpaketphonebefore contentcolor 2sinfoboximgwrapper imgtextabsolute6px 10px colordisplay inlineimportantborderradius 050 maxwidthflexbasisnavsubmenuderutilhxsmsflexpreferredsizemenumain litooltiptriggerfooterfootnotelawhighspeeddatenvolumens 216 mbitscontentnowrap marginstagehighspeeddatenvolumen maximale geschwindigkeitbottom 0monatlaufzeitaldi talk basistarifnormal fontweightbtngroupright lispan fontsize10px 01rempadding 0badgeflexgrow 1 maxwidthvisibleofferteaserflexmsflexpack centerdownloadmargintop 0 marginbottomaldi suedfontfamilyborderboxutilnomobilelogologoname70px 6px 10px6666667 flex 0leistungserbringer400 letterspacingrelative paddingleft 0 topbackground webkitgradientlinear leftfloat left paddingrightimg displaywhitespaceimportant topcolor fff displaybackgroundrepeat norepeatwebkitboxshadow 0 2px0 navservice tooltipflyoutinklusiveinheiten verfallen amfooterfootnotelogosfloatabrechnungszeitraums max 560 navsubmenuslickslider slickarrow10px paddingknnen6666667 flexp margin 0nokia 13senkung400 fontstylepaddingrightposition absolute width100 textaligntextdecorationwebkitboxordinalgroup 1 msflexorder0 5vertical webkitboxdirectionzum aldifff borderradiusborderwidth0 0 3333333das30px 010 order 10accordiontrigger footerfootnotelaw fontsize2s transition0 display1 13msflexorder 1 ordernoneimportant media86 mbits im0 1666667 maxwidthff4141des jew143 msflexordernone media screenborderradius 10px padding3751wunsch mitmaximalecontainer uspboxlist bodynotcmsindexindexnotcheckoutindexindex10px 10px 0ltenbsp19 euroaminginklusive produktdetails produktinformationsblatt0 9166667arial sansserif sansserifwunschcolor fffsrcease875rem lineheightf4b800column flexdirection columnwebkitboxordinalgroup 3highspeeddatenvolumenmargin 0 02px 3px 10px0 bordercolortextareanichtzum ende9999px0 5pxabsolute right 0absolute rightdisplay inlineblockwebkitboxalign center msflexalign0 00 833333 flex0 1666667center msflexalign centernone tooltipflyoutinternetflatrate s100 webkittransformcursor pointer9166667 maxwidthformpersonaldata tooltiptextwrapperbeforembits im downloadnone marginbackground fff19formfieldwrapperisinvalid6px 70px 6pxtabsnavigation lihoverinfinitetopposition relative widthright media screen150px11msflexorder 10 orderheight autoorder 224px transform translate0flex media0 tooltipflyoutwidth 0dieorder 04 order10px rgba0 011 ordersearchlayerlihoverlineheight 150die preise gem0 8333333 flexliststylebei dertop 0 leftbackground f4f4f4center textdecoration noneeuausland ohnepointereventsrelative widthallverbrauchmsflex 1rgba0 03 order 323 fontweight 400lineheight 14emtabstextease transition transformbordercolor ff4141thwebkitboxdirection normalborderbottom 1pxleft paddingright 5pxh2rgba0internetflatrate xl0 margin 0h6visibility hidden0 lineheight 0antialiased mozosxfontsmoothing001e78 mediawebkitgradientlinear leftcontent positionutilonlymobileaufslickdots li button0 20px rgba0padding 10px 40px13 order1666667 flex 0accordionmobile accordiontrigger accordionmobiledisplay msflexbox displaywebkittransform rotate0 transformwebkittransform scale120px 0footerfootnotelawafter rightbordercolorpaketinklusiveinheiten verfallencolor fff paddingmaxheightmsflexorder 6 orderbutton heightfrom5f77bf to001e78ccc media screenl whlen aufbuchbarutiliconbeforeutiliconwwwbefore6s ease10px paddingleft 10pxabzug gebrachttarif enthaltenentable td thmaxwidth479375empaddingtop 0importantlogologoname span fontsizewidth 100fff colorstundensolid eb5a0c zindex6s ease transitioninternetflatrate mit9 msflexorderslickdots linone padding2s easeanderes smartphone internetflatratehintlistitembefore fontsizeedgelisttarif17px left 29pxorder 1formatsvg fontfacewidth auto maxwidth0 0 2basistarifcaption43smartphonecontainerbackground rgba0 00 6666667 flexformpersonaldatapadding 0 footerenthaltenen highspeeddatenvolumens 216color 001e78 media2s webkittransformwidth 100 heightbackground 00 2order 9localopentextdecoration none tooltipflyoutrgba2559166667 flex 0mit passendemfooter titleanderes smartphone whlenblock position relativewebkitboxshadow none0 rgba0 0formerrorwhitespace nowrap marginfooterfootnote textalign0 0 50background 004b9cmotorola edgehtmlmmopeningmsflexpack center justifycontent3s easebtngrouprightwidth 50pxtranslate0margin 0 10pxbis zum verbrauchproduktinformationsblattrelative width 10020px textalignauto flexposition absolute leftmarginleft 50lineheight0 0 4166667footerfootnotelaw padding2px 3px100 flextooltipformauto maxwidthmarginbottomeaseout transitionright mediahighspeeddatenvolumens 216gbhighspeedinternet inklflexbasis 0eb5a0c zindex 2msflexorder 5 order12 msflexorderwebkittransform scale1 transform1px15 media screenleft paddingrighticonfont sansserifmsflexdirection row flexdirectionzum ende desbackgroundsizelineargradientto17px1875reminternetverbindungmarginleft 10pxdisplaygeschwindigkeit bis zumwebkitboxordinalgroup 4 msflexordernormal msflexdirectionluxembourg2px 4px 07relative lineheightpaket mbackground webkitgradientlinear001e78 backgroundsms euroamingcenter alignitems100 opacityff4141 formfieldwrapperisinvalidsolid 1px0importanteuroaming inklusive0 media screeneuausland ohne sondernrtarifteasertitlefontsize 375rem100 leftmsflexorder 13 orderslickslider slicktrack15remauto maxwidth none2 boxshadow 2pxp125rem borderdisplay webkitboxorder 8175remverbrauch des impaddingbottom 20px10margin 20px0 5833333passendemwebkittransform 5sborderradius 5pxsind2 msflexorder 1tarif0 1666667 flexdanach bis zuminlineblock heightbackground rgba255top left bottomsansserif fontweightmusikpaket l1299 inkl 10webkitboxordinalgroup 7transitionlineheight 15001e78 fontweightwebkittransform translatey50 transforminklusive produktdetails zumbtngroupcentered6 msflexorderdisplay block contentzu denmarginleft 9166667 mediagrayscalefontsize 175reminlineblock padding5833333 flexheaderstickystickywrapperisstickytarifteaserdetail paddinggesprcheeine0 bottom 0normal speak nonemargin 20px 0width autofontsize 1rem mediatarifteasertitle textwrapper0 right100 opacity 1table captiongbhighspeedinternetsenkung der mwstleft 0padding 0 margin30px10px 40pxslicktrack0 opacitycontent clear1px solid cccjederzeit0 position absolutemozosxfontsmoothing grayscalefontsizeabzindex 026header headerstickyeb5a0c bordercolor8zzgl einmaligblock margin 13px75 flexboxsizingeuweite internetflatrate5px mediasolid eb5a0ce2e2e2automatisch voninternetflatrate labsolute top 0sans fontstylegesprche smswebkitgradientlinearfontfamily open8 msflexorderzu4pxutilshowgridslickarrow slicksliderorder 10sondernrheight 0 overflow4 msflexorder 3ohne sondernrinputnottypecheckboxnottyperadioformlabelmusikflatabrechnungszeitraums14 msflexordermsflexorder 13upload danachmenumain lihighlight300 fontstyle normalnone padding 0perfontsize 15remwhlen100 flex 040px width autodisplay flexzzgl einmalig 1299speak none8 ordermonatlaufzeit 12 monate150mswebkitboxshadow 2px 3pxcolor 9d9d9dstageteasernone mediamehrwertdienste euweite internetflatrate10 msflexorder 9screen and minwidth48emtabstexthoversearchlayercontenttransform translate0display noneimportanttextalign left media10 startguthaben senkungsolid50 marginleftimgproductslider paddingease transition color10px rgba0spinnerloder0 mediamaxwidth299375emnachofferteaserflagpadding 20px 40pxopacity 3saccordiontitlezzgl34padding 6pxinklusiveinheitendisplay noneimportant mediaright 40pxaccordionmobilemiddle4 wochen2 boxshadow80px media screenknnen sieutiliconbeforeutiliconmusicbefore contentli span1px solid 8da8b3msflexpositive 17 order4sselectfontweight 800bordercolor eb5a0c colorfooterpaymentlogosease transition webkittransformwebkittransform 5s easeflex webkitboxalign centericonfontluxemburg17px leftbottom from5f77bfgem roamingpreislistetransform 2snorepeatjustifypaddingleft 10pxtextalign rightdisplay block textalignmsflex 0 00 100 maxwidthffba00zindex 2 marginmarginbottom 40pxjustifycontentder mwst10px borderradiusdatenverbindungen8333333 flex 0uspboxlistitemdisplay block widthmargintopdisplay block height2smmlistview381px 0000 top 50borderbottomsmartphone whlencolor fff textdecorationformfieldwrapper1 mediatextwrapper0 marginbottomwebkitboxsizingtextwrapperbefore fontsize12marginbottom 10pximportantspanmbits imnone webkitfontsmoothing10px 0 0transition transform 150mstable caption fontsize400 fontstyle normalsondernr mehrwertdienste euweite12 monate starterset10px marginbottompreisen in abzug5px 6px rgba0webkitboxdirection normal msflexdirectiontarifteaserlihighlight0 lineheight3333333 flex 0border solid 2px0 40pxcolor 4a4a4aden20px marginbottom 20px9 ordercurrentpricemonthly0 borderf4f4f4tooltipinlineimportantutiliconafterutiliconpaketphoneafter utiliconbeforeutiliconpaketphonebefore contentepsinlineblock width5f77bfnone whitespace nowrapnone position001e78 colorlocalopen sansflexdirectionmarginright 10px7 msflexorder 6padding 6px 70pxslidernavcontaineraccordionmobile accordiontriggernavservicelogowrapper logocurrentpricetarifteasertitle textwrapperbeforedisplay block0 0 100msflexorder 4padding 20pxorder 5100 maxwidth 100webkitboxalignmarginleft 666666712 order33screen and maxwidth479375em0 20px 0webkitboxordinalgroup 5 msflexorderlilastchild marginbottomposition absolute topleft bottom from5f77bfh3am laufzeitendedemwebkittransform 3s easeoutwebkittransitionmsflexbordertopwhlen anderes smartphoneproductslideragbeaseouttransform 150ms easeauto rightwebkittransform 150ms easeabsolute leftbackground lineargradientto bottomgrayscale fontsize24px colorcolor 002c5c153px 10pxactivewird automatischmsflexorder 9fontsize 8125rem displaytranslate50 50border solid0 0 9166667unter0 footer linksopentransform translate0 24pxflat unbegrenzte gesprche0 20pxtranslate0 24px transformformatembeddedopentype0 4 boxshadowformfieldwrapperisvalidborderright 1pxcontent clear bothright 10pxlinksmozosxfontsmoothinglineartransform rotate0lineheight 0utilh1 h1gb highspeeddatenvolumen maximaleroamingpreisliste1scenter0 0 30pxsidebar width0 25borderradius 10px 10pxistvisibility visibletabsnavigation liactivebei aldi8125rem content importantcolumn flexdirectiontextalignease transition allf6901binputnottypecheckboxnottyperadio32wochen zzglmarginleft 25border nonetextdecoration underlinecenter justifycontent centermwst wird automatischlife musikslicktrackafterslickarrowflexdirection columnsup fontsize0 zindexwebkittransform translate0 24pxaldifontweight 700 mediamargin 0die preisedownload und 867 msflexorder14 msflexorder 13255 255mmmenuinnerhalb deutschlandsh3 fontsizeselectformlabelblock textalign100pxinkl ltenbsp19fontweight 70029li a fontsizefootercheckoutcontent ul9px 0fontface fontfamily openeb5a0c color fffinputnottypecheckboxnottyperadioformlabel formtransitionbottom 5f77bfposition staticsanswebkittransition all1 auto10px borderli btngroupcenteredpadding 5px50px height 50pxeb5a0c color0 padding 01 msflexpositivetable td25 flex 0searchlayerimagefontsize 25rempaddingbottommarginleft 3333333sienormal texttransform noneguthaben0 marginbottom 20pxmmnavbarwebkittransform 4sflex 0 0searchlayerimageanavsubmenu submenuteaser6px rgba020px leftdisplay block padding2px 4pxbackgroundlineheight 23100 margin0 5833333 maxwidthleft topletterspacing 6pxhintlistlistoutline 0left 0 rightwebkitboxpack centerrechtespaltetransform translate3d0mediarotate360degverbrauchte inklusiveinheiten0 0 5833333uspboxbenefitsbodynotcmsindexindexnotcheckoutindexindex pagemain bodynotcmsindexindexnotcheckoutindexindexber0 33333330 footerautomatischscreen and maxwidth299375emselectformlabel formtransition100 height autoheaderminwidth8125emtextareaformlabel0 50 maxwidth2 msflexorderfloat left40mein0 0important0 padding4166667 flexsubmenuteaseraccordiontrigger accordionmobile footerfootnotelaw0 0 25whlen auf wunschauto padding 0tabsnavigation lihover backgroundtextalign center padding10 msflexorder50 webkittransform translatey50von regulrentalk paketfooterfootnotecontenthiddenabsolute left 0bodynotcmsindexindexnotcheckoutindexindexcolumnfff padding 20pxopacity 2smsflexitemalign25 flexwebkitboxordinalgroup 14 msflexorderinkl ltenbsp19 flatfrom5f77bfcenter textdecorationmaxwidth 666666710 startguthabenhighspeeddatenvolumen maximalepowered by napsterslickdots lislickactivetransparent1emspeakflat unbegrenztefontweight 400 fontstylefloat left mediatexttransform nonetitlekachel3container1 flexgrow 1none mmmenu0 0 5webkittransition webkittransformmsflexorder 4 order8 msflexorder 70 30pxrow flexdirection row9px 0 rgba0upload danach bisbackground fff borderradiusutilnomobile display10px 20pxmozosxfontsmoothing grayscale fontsizepreise5px 40pxmsflexdirection columntextalign center textdecorationmaximale geschwindigkeit bisfontsize 0display inlineblock paddingnone margin 0width 20pxmsflexorder 11 orderoboxshadowinfoboximgwrappersms innerhalb0 10pxmsflexorder 12 orderpriceboxbigwebkitfontsmoothing antialiased mozosxfontsmoothingnone lineheight 16pxwebkitboxordinalgroup 135833333 maxwidth 5833333webkitboxflex 1 msflexslickslider1gratiscontent position absolute13 order 13accordiontriggertalkrightpadding 20px 20pxtagenormal texttransformgbhighspeedinternet inkl ltenbsp19normal msflexdirection columnbtnghostscale75padding 0 40pxformtransition formfieldwrapperisinvalidtabsnavigation a spanclassutiliconmsflexorder 8 orderalcatelfooter linkspagelayout2columnsleft columnmain4920px mediammopeningfff display block13px 0animationende deswebkitboxorient verticaltranslatey50 transform translatey50padding 5px 08125rem displayklarnanicht verbrauchteblock productsliderlifepreise gemmaxwidth 1666667footerfootnoteslidernavinkl ltenbsp19 euroaming0 8333333 maxwidthdatenverbindungdisplay msflexboxformtransition formfieldwrappermarginbottom 0importantsolid 1px 000webkittransform 150ms5833333 maxwidthltenbsp19 flat unbegrenztehorizontal webkitboxdirectionbis zum endeh1375rem9 order 9inkl 10msflexorder 3marginleft 02010px textaligngalaxyangegebenenheight 50pxbackground fff textdecorationbei0 0 autoleftpadding 0px 0ltenbsp19 flat0 ordertop 50 webkittransformposition absolute zindexsrc localopengeschwindigkeitwidth 35footerlinklist litarifteaser btnwochen zzgl einmaligboxshadow nonenavservicetext9166667 flexxlfontweight 400 positioneuro 4relative displayinfinite linearpowered20px rgba0 0linear transitionmaximale geschwindigkeittooltipflyoutaccordiontriggerafterlilastchildproductslider slickarrow slickslidermmenufixedhintlist display0 auto paddingwebkitboxordinalgroup 0msboxshadow0 10bodynotcmsindexindexnotcheckoutindexindex pagemaintabletsbaselinestretchcontent display blockminwidth30empromotionbtnlogo2s linear transitioncontent display1 flexgrowul liwunsch mit passendemtextdecoration noneli a padding3 orderblockinlineblock3s easeoutm whlen100 displayfontsize 875remtop 8pxposition relative displaypagemain bodynotcmsindexindexnotcheckoutindexindex24 monate starterset5productslider slicktrackbordertop 1px solidtarifchange fontsizeverbrauchte inklusiveinheiten verfallen42mit passendem smartphonewebkittransform rotate0deutschlands18fixedblock widthtransition webkittransformblock textalign centermaxwidth 9166667msflexorder 1050pxsolid ccc mediaformspeak none webkitfontsmoothing1666667 maxwidth 1666667abzug gebracht internetflatratestartguthaben senkung derflatcolor 6s easeheaderstickybis zum22marginwebkitboxordinalgroup 60 position relative50 fontsize216 mbitsopacity 0verticalalign middlerelative display inlineblockfontsize 2375rem6 order 65 msflexorder 4submenuteaser liratenkauforder 130 overflow hidden80pxwebkitboxordinalgroup 5jew abrechnungszeitraums max0 backgroundfontsize 0 lineheightsansserif sansserif fontweightampadding 15pxmonatlaufzeit 120 navsubmenu submenulistlaufzeitende700 paddingutilh3 h3 fontsize5px 0block margin 00 50webkitboxordinalgroup 6 msflexorderpagemainlislickactive button0 2pxopacity 1 502margin 10px0 50 flexeuroaming50px heightwebkitbox display msflexboxhorizontalist dieslicksliderinfowrapperbtngroup li btngroupcenteredlipricebox taxesmarginleft 759d9d9dfrheight 80pxfontsize 875rem lineheightpagelayout2columnsleft sidebar widthmsflexorder 10 textalign center0 75 flexwebkitboxflex 127130 left 0center msflexpack center75 maxwidthflexdirection rowbackgroundrepeat norepeat backgroundsizehidden media screenminwidth30em offerteaserflagzindex 2rotate0 transformform textarea15sregistrierungenthaltenenmmenufixedhintlistgesprche sms innerhalb2 margin 0zindex0 webkitboxflexwebkittransform 2s5f77bf 001e78fontsize 75remgebracht internetflatratebothmsflexpackwhitespace normal10pximportanttarifoptionentarif enthaltenen highspeeddatenvolumenspadding 20px 0stepsitembottom from5f77bf to001e78utilicononlylineargradientto bottomwebkitboxshadow0 bottompaddingright 10px0 0 83333330 4166667 maxwidth8da8b3formtransition formfieldwrapperisvalidenthltfontsize 1375remmsflexorder 11height 100hintlistmobilecenter displaymehrwertdienste euweitemarginbottom 40pximportant6s0 0 1remtransition transformroamingpreisliste unter wwwalditalkdeh4msflexpositive 1 flexgrowheight 3px0 color 001e78list7 order 7visibilitye9f6ffbordercolor eb5a0cwebkitboxregulartextalign left12 msflexorder 11slicklistdatalayer6pxder mwst wirdblock position absolutebtngroupcentered li btngroupinlineaccordiontitle accordiontrigger70px 6px36zu aldi talkum diegem roamingpreisliste untermargintop 10pxnicht verbrauchte inklusiveinheitenposition relative lineheightmaxheight 40px widthwebkittransform translate3d0deshintlistitembeforeim tarif0 liststyle1299 inklmwst wirdletterspacing normal texttransform12 monateorder 4footersenderlogosabzug gebracht paketabsolute top 501 msflexorderdisplay block medianone boxshadow none23mwstfooterlinklistohne sondernr mehrwertdienstegebracht paketnorepeat backgroundsizemsflexorder 8productslider slickarrowaccordioncontenthiddenutilh2anderesslickarrowslickhiddenlineheight 23 fontweightkannsansserif fontweight 400accordiontitle accordiontrigger footerfootnotelawtitle footeralleroamingpreisliste untertop auto bottom8333333 maxwidth 8333333inputtyperadiolabelafterutiliconafterutiliconwwwafterwenn875remproduktdetails zum833333 maxwidthcenter justifycontentwebkitboxflex 00 navservicepaddingright 10px paddingleftpricebox1 order 1400 positionauto textalignsamsungtranslatey50gelten dieborderradius 100none webkitboxshadowaldi talk13pxfontfamily iconfontcenter width50 flexcontainer125rem833333 maxwidth 83333320px marginbottom0 auto widthlinks titlemobilemenutoggle100 media screenmsflexpreferredsize 0 flexbasis24pxmarginbottom 20pxbackground 0 0background ffba00verbrauchteproduktdetails1 maxwidth 10020px colormaxwidth 100270px6translate50display inlineblock height0 display block0 zindex 99fontweight 700 paddingtraccordiontrigger accordionmobilepromotionbtn fontsizeflex media screentarifteaserdetailli padding 10pxslicksliderstage slicklist355pxwebkitanimationclear both fontsize0 0 833333flex webkitboxorientltenbsp19 euroaming inklusivemarginbottom 0passendem smartphone zbleft medianach ablauf geltenantialiasedwird automatisch von1 auto flex601 und smseinmalig 1299 inkl0 25 flexminwidth480pxbottom 0 leftwebkitkeyframesorder 12fontstyleeb5a0c zindex0 4webkittransform100 textalign centerpadding 0 20px0 0 20pxmmopening mobilemenutogglesupcolorfff padding20px backgroundcenter mediaslickslider slickarrowbeforetarifteaser btn fontsizewebkitboxordinalgroup 9 msflexorder16pxpadding 10px 20pxwebkitboxordinalgroup 4maxwidth619375emdisplay none mmmenu4 msflexorder0 833333produktdetails zum paketletterspacingwebkitboxordinalgroup 9widthtalk basistarif enthaltenboxshadow 2pxwebkitgradientlinear left topproduktdetails produktinformationsblattccc mediajustifycontent centerli btngrouprightnutzung1rem mediaposition relativefadeinright 15webkitboxpackfloat rightmsflexorder 0 orderblock height20px media screenleft 500 heightslickarrowfocuswebkitboxdirectionl 99910 orderoutlinesmartphoneblock width 1005px 6pxnavservice tooltipflyout ulmargin 13px 0im uploadbackground lineargradienttomaxwidth none0 msflexleft bottom4a4a4aliststyle noneheight 30px15 mediaborderright 1px solid3px4s transitionuspboxlist bodynotcmsindexindexnotcheckoutindexindexendeslickslide6px rgba0 0ahover24 stundenmsflexorder 9 ordergesprche und smshidden1 1 autopaket lwebkitfontsmoothing antialiasedlineargradientto bottom 5f77bf0 0 4marginleftnavservicelogowrapper13 msflexorderproductslider slidernavcontainer slidernavbuchbar zum aldi2846danach bisalastchildsolid cccpointerbtngroup liopacity0 2px 4pxalignitems centerdeutschlands und imvon regulren preisentabsnavigationminwidth992pxhighspeeddatenvolumensproductslider slickarrowbeforemedia minwidth992px160 8333333zindex 99auto flex 1bis0 4pxmarginright auto0 flexbasis300 fontstylesans arial sansserif4 boxshadowopacity 15833333 flex 0normal speakvonbackground rgba255 2552375remoldpriceboxshadow 0open sanscenter alignitems centeruldisplay block positionmax 56abeforefontweight 300hintlistsmall40px 0fontface fontfamilymsflex 0fontweight 4004 wochen enthaltenmsflexpositivebackground fff colorsmse8e8e81 msflex23 fontweightborderradius 10px002c5ctextdecoration none webkitboxshadowwochen enthalten gesprche0 auto25 maxwidth 250 15pxlineheight 16px8125remstepsitemaftertalk musikpaketrgba255 255 255einmalig 12991666667 maxwidthcolor 6snone webkitfontsmoothing antialiasedtabsinternetflatrate mborderradiuswebkitboxordinalgroup 12 msflexorderwebkittransform 2s linear001e78 tabsnavigationtransition alllinks liauto flex 0webkitboxpack center msflexpacksansserif sansserifaldi lifehintlistpadding 0 0webkitboxordinalgrouppreise gem roamingpreislistebtnpadding 2pxffce4dpreisenleft 29pxflex 1 10 100 flexwebkittransform 3sdisplay none mediascreen and minwidth62emnavserviceulliawebkitboxordinalgroup 8 msflexorder0 0 colornone navsubmenu submenulistauto bottomnormal fontweight 400u schweizright 20pxuspboxsealsproductslider slidernavboxshadow 0 2pxscale1 transform scale1list uldisplay inlineblock widthslickslider slickdotsbuchbar zumboxshadowim tarif enthaltenenwebkitboxorientminwidth768px10px colorstarterset gratisanderes smartphoneuspboxlist70pxmsflexdirection rowtransform20px rgba0flexgrow 1webkittransform translatey50textalign center display4510px 10pxfontsize 8125rem content10px widthoderbackground eb5a0c bordercolor40px001e78 media screeneb5a0ccolor 001e78 fontweightfooter links lieuroaming inklusive produktdetailsoverflow hiddenopacity 5fontfamily open sansbtngroupcentered likeineerfolgtcolor ff41410 4166667 flexenthaltenen highspeeddatenvolumensdes im tarifpaddingtopcontent important topblock content clear0 9166667 flexslickarrowbeforetransform scale1boxshadow 0 0position relative padding700 mediarotate01px solidopen sans fontstyle14pxborder solid 1pxbackground 001e78 backgroundboth fontsize 00 9166667 maxwidthcenter msflexalignli display inlineblock1 msflexorder 0001e78redclear52musikpaketfontfamily aldi suedabzugorder 6padding 30pxbordercolor 54ca8eli paddingccc36pxheightsansserif1375remwebkitfontsmoothingmsflexalignslickarrowhoverwebkitboxorient vertical webkitboxdirectioninputtypecheckboxformerroraccordiontriggerafter footerfootnotelawafter24lineheight 14productslider slidernavcontainernone webkittransitionease webkittransform100 height001e78 fontweight 700senkung derfooterfootnotelaw fontsize25rgba255 25540pximportantutilh2 h2msflexorder 0btngroup5s ease transitionunderlinebackground eb5a0copen sans arialeuweite50 flex 0block media0 webkittransform rotate02s linear10px mediascale1 transformfontsize 1remwebkitboxsizing borderbox13px 0 paddingnowraporder 350 webkittransform9 msflexorder 8fontfamily iconfont sansserif0 3333333 flexminwidth30em tabsnavigation10px paddingleftwrapper padding0 0 1666667none navsubmenu0 5px 6pxlineheight 0 heightcaption fontsizecolor 54ca8ecurrentpricemonthly fontsizecolor eb5a0c100 borderradiusbtnsecondaryrgba0 0 0absolute width 100maxwidth 833333utilh3 h30 0 6666667wwwaldilifecomwhitespace nowrap0 auto textalign0 rgba06 msflexorder 5motorolafontweight 400 letterspacingslicklistdraggingnone lineheightaccordiontrigger footerfootnotelawtable trletterspacing normal4 boxshadow 0flexgrowcolumnmain widthease transitionregulren preisenwhlen anderesim euausland ohnefontsize 125rem bordersms innerhalb deutschlandswwwalditalkdeproborderbox boxsizing borderboxerforderlinkl8333333 maxwidthleft 50 webkittransformpadding 10px40px media screenjeweils5px solidwebkitboxshadow 2pxdisplay block marginwrapperfff textdecoration nonetranslate3d0 0833333 flex 0euweite internetflatrate mitmarginleft autowebkittransition colorordertransition color0 positionformtransition15px 0inkl 10 startguthabentransition transform 2sto001e78 background4166667 flex 0left 10pxmargintop 20pxstartguthaben senkungweiteresamsung galaxy400 letterspacing normalmenumain liactivenavsubmenu submenulistverbrauch desleft 50 marginleftwebkitboxordinalgroup 112px 9px 0block positioneuro0 msflex 0sichauto width autoutilh1menumain8125rem contentdisplay webkitbox displayslicksliderstage0 webkittransformnach ablauf500pxauto textalign leftdisplay flex webkitboxalign0 25 maxwidthscaley1auchright 04140px width75rembottomabrechnungszeitraums maxstartguthabenwebkitboxflex 1 msflexpositivetextalign center25remvertical2px1666667 flex0 75 maxwidth29pxmargin 0 paddingmarginright0 10025pxslickdots9border 1pxim euauslandauf wunschcolumnmainprepaidsolid 8da8b3minwidth30em footeru0 0 75transform translatey50normal0 topfooterfootnotelawafteropacity 2s webkittransformlislickactivebottom 5f77bf 001e7831borderzum verbrauch dessmartphone zbalignitemsslicksliderteasermsflexorder 3 ordersans arial4px 0 rgba0umborderbox boxsizingnavservicewebkitboxordinalgroup 0 msflexorderfooter0 2px 9pxproductslider slickdotsabsolutelinear animationtalk basistariffffright 0 top19pxtarifteasertitle textwrapperbefore fontsizezb0 6666667 maxwidthmonatlaufzeit 24pagelayout2columnsleft columnmain widthtabsnavigation li40px mediamsflexbox displaywebkitboxordinalgroup 1421msflexorder 6src localopen sanspadding 10px 00 height 0btngroupinline li btngroupright100 maxwidtheuro 4 wochen2px 10pxleft top left0 textalign leftflex webkitboxalignformatwoff2enthalten gesprche sms1 orderboth fontsizescreenwebkitboxordinalgroup 2 msflexorder0 flexbasis 048marginleft 5833333tabledes impositiontop 3px0 fontsizemaxwidthnavserviceright0 75tooltipflyoutafteruluiautocompletewebkitboxshadow 0ohneproductslider slickdots limitminwidth62emunter wwwalditalkde50 maxwidth 50auto media screenpricebox oldprice20pximportant0 190 liststyle nonesidebarmaxwidth 5833333float noneofferteaserlist ulopacityloaderzum verbrauch9166667 maxwidth 9166667ampnavsubmenu submenuteaser liform inputtyperadiolabelafter11 msflexorder 10border 1px solideuauslandarialtop 50background 001e781 msflex 1lilastchild marginbottom 0lifirstchild0 mmmenutextalign center media24px transform0 colormotobordertop 1pxtabsnavigation a fontsizenavserviceullimsflexalign center alignitems3ssolid 2pxtranslatey50 transformwebkittransform translate0taxesfontsize 1125remhintlistitemnone displaymaxwidth 3333333maxwidth 25slidernav slickdotsformatsvg3333333 flex100 margin 07 tage0 widthscreen and maxwidth619375em56 kbitsfontfamily aldimonatlaufzeit 24 monatelaufzeit 7highlightloadertop 0transform 150msfontsize 9375remfontweight 300 fontstylebottom 8wochen enthaltenblockservicelayermusikdes jew abrechnungszeitraumsrotate0 transform rotate0productteaserimageonly0 top 0th fontsize0 msflexorder50 lefteaseinoututiliconafterutiliconmusicafterheight 20px0 overflowmglichbtngroupinline liblock media screengeltendisplay inlineblock backgroundvon aldipagelayout2columnsleft sidebar75 maxwidth 75diesemonate starterset gratisopacity 3s easemarginleft 833333375 flex 0flexdirection column webkitboxpack0 4166667enthalten gesprcheinfoboximgwrapperafterwochen enthlt euweitemargin 0 mediaclear both2 margintop auto1 50position absoluteim downloadbasistarif enthaltenzu aldi4166667 maxwidthmsflex 1 1msflexorderutiliconafterutiliconpaketphoneafter utiliconbeforeutiliconpaketphonebefore3s easeout transitionblock paddinggebrachtcursor001e78 background webkitgradientlinearmsflexorder 5gb highspeeddatenvolumenmaxheight 40px8pxnone whitespaceaccordionmobile footerfootnotelawhidden media5s easeinfos3px widthwebkitboxflexmargintop 0webkittransition opacitynone position absolutel whlenpaddingleft25 maxwidthauto bottom 8upload4px 0display nonetarifteaserdetail padding 10pxblockimportantbackground fff paddinglihover backgroundfootersenderbackground rgba0borderbottom 1px solidminwidthbackground e2e2e2noneimportant media screenfffimportantmsflexdirectionsondernr mehrwertdienste1 maxwidthzindex 112 order 2msflexboxwidth 50px heightflex 0napsterorder 70display blockimportantzindex 3relative zindexwhlen aufimgtextabsolute0 0 19enthalten0 auto flex20px 20px 20pxstartersetto001e78top 20pximantialiased mozosxfontsmoothing grayscalemsflexpreferredsize 0wochen enthlt0 3333333 maxwidthtarifchange0 borderradiuswebkitboxordinalgroup 11 msflexordernavservice tooltipflyoutslickslider slickdots liwebkitboxshadow none boxshadowspanclassutilicon fontsize3333333 maxwidthwebkitboxflex 0 msflexminheightliactivealdi talk musikpaketblock margintooltipflyout ulfontsize 8125rem0 833333 maxwidthauto widthdanachtop 17pxto001e78 background lineargradienttofootercheckoutcontentsansserif fontweight 300utilh3inputtyperadiolabelbeforeinternetflatrate6px 70pxmax 56 kbitsli ahoverfontstyle normal0 slicksliderstagewebkitboxordinalgroup 3 msflexordermbits im uploadtextindentrow flexdirectionkbitsauto mediambitsnavserviceulliaisactiveafter4 wochen zzglscreen and minwidth8125emmusikflat aldi lifemargintop 0important0 3btngroupinlineautomatisch von regulrenmehrwertdienstemaxwidth 75mmmenu mmlistviewformattruetypepointerevents nonepagelayout2columnsleftborderrightdisplay none slicksliderstageli display5 msflexorderimportant top 50webkitboxordinalgroup 13 msflexorderscale1top 50 leftboxshadow 2px 3pxfontstyle normal speakpaddingright 5pxtooltipflyoutbeforecolumn webkitboxpackfooter links title39formatwoffwebkitboxorient horizontal webkitboxdirectiontexttransform none whitespaceinputtyperadioformerrorauto padding4 order 4display block productsliderp marginshighlightedl11 order 11margin 13pxwebkitboxordinalgroup 10none slicksliderstage6 order0 lefttexttransformall 6s ease12 order 12scalex1msflexalign centerbackgroundimageaccordiontriggerafter footerfootnotelawafter fontsizeinlineblock backgroundvomform inputtyperadiolabelbeforezindex 1marginleft 4166667color 001e782s webkittransform 2sm6666667 maxwidthli button7 gbpadding 0 10px0 right 00 textalignsms euroaming inklusivepadding 40pxinnerhalbflex 1minwidth62em navservicelogowrapperslickdots lislickactive button13 msflexorder 120 margincenter msflexpackspanafterim upload danachsans fontstyle normalfontsize 125rem15pxschweden8 order 88333333 flex700 media screen150ms easeoverflow hidden media20px 20pxnbspwebkitboxordinalgroup 1fontweightutiliconbeforeutiliconwwwbefore contentflex webkitboxorient vertical100 height 100vertical webkitboxdirection normal10px color 001e78normal msflexdirection rowjew abrechnungszeitraumsborderradius 50webkitboxorient horizontal6666667 maxwidth 6666667musikpaket mmaxwidth 8333333wochen5smsflexbox display flex0 webkitboxflex 1webkitboxordinalgroup 12passendem smartphonepaddingleft 0monate0 2 boxshadowaldi life musiknoneimportantmsflexorder 2 orderwidth 100 displayblock content0 6666667regulrentransition opacitynone boxshadow17msflexorder 7 order216 mbits imwidth 100 mediaofferteaserimagemarginleft 916666730alignself10px rightul li fontsizeleft autocenter media screenfontsize 1875remuspboxlist bodynotcmsindexindexnotcheckoutindexindex pagemainfooterfootnotelawafter fontsizespanclassutilicontranslate0 24px colornbsp nbsp nbsp1rem media screeninklusive produktdetailshorizontal webkitboxdirection normalabsolute widthimg width54ca8eli fontsize 1125rem9pxeuro nbspverfallenfr diefff displaywebkitboxordinalgroup 8msflexorder 7order 115 order 5top 17px leftstatic2px solidstepsitem h4unbegrenztelogologoname spankeyframespaddingright 0fontfacegemheight 3px widthwebkitboxshadow 0 0importantnone width470px 010px leftschweiz0degdisplay flex webkitboxorientcolor 999mobilemusikflat aldicolor 525252offerteaserbtnabsolute zindexnavservicelogowrapper logologoname span004b9c43px14emnowrap margin 0msflexorder 2padding 0 media12px001e78 color fff20px24 monateenthlt euweite internetflatrategbli btngroupinline25ssmartphones833333 flexutilonlymobile display0 5833333 flex0 0 3margin 5px20px 40px86 mbits0 productslidermaxborderradius 50px21px0 0 0webkitboxordinalgroup 2arial sansserifslickarrow slickslider slickarrow

Longtail Keyword Density for Alditalk.de

KeywordsOccurences
-webkit-box-flex 0 -ms-flex67
0 -ms-flex 065
flex 0 065
-ms-flex 0 065
screen and min-width48em60
screen and min-width62em52
rgba0 0 045
screen and min-width30em42
-ms-flexbox display flex27
display -ms-flexbox display27
-webkit-box display -ms-flexbox27
display -webkit-box display27
0 overflow hidden27
0 line-height 026
0 height 026
height 0 overflow25
display block content25
block content clear24
clear both font-size24
both font-size 024
font-size 0 line-height24
line-height 0 height24
content clear both24
position absolute top23
background 0 017
font-family open sans16
0 rgba0 014
none media screen14
0 media screen14
width 100 height13
margin 0 auto13
open sans arial12
sans arial sans-serif12
1px solid ccc12
-webkit-font-smoothing antialiased -moz-osx-font-smoothing12
antialiased -moz-osx-font-smoothing grayscale12
0 right 012
-webkit-box-direction normal -ms-flex-direction12
none -webkit-font-smoothing antialiased11
speak none -webkit-font-smoothing11
normal speak none11
mbits im upload11
86 mbits im11
216 mbits im11
margin 0 011
mbits im download11
0 0 211
zum ende des11
font-style normal speak11
download und 8611
content position absolute11
position absolute left11
im tarif enthaltenen10
im upload danach10
upload danach bis10
danach bis zum10
bis zum ende10
10px rgba0 010
0 0 333333310
ende des jew10
des jew abrechnungszeitraums10
jew abrechnungszeitraums max10
abrechnungszeitraums max 5610
max 56 kbits10
des im tarif10
0 0 916666710
maximale geschwindigkeit bis10
geschwindigkeit bis zum10
bis zum verbrauch10
zum verbrauch des10
verbrauch des im10
0 0 2510
0 0 416666710
0 0 166666710
display none media10
0 0 83333310
0 0 410
0 0 auto10
product-slider slider-nav-container slider-nav10
0 0 10010
0 padding 010
display flex -webkit-box-orient10
0 0 666666710
0 0 5010
0 0 7510
0 0 833333310
0 0 583333310
automatisch von regulren9
0 left 09
screen and max-width479375em9
wird automatisch von9
mwst wird automatisch9
tarif enthaltenen high-speed-datenvolumens9
preisen in abzug9
der mwst wird9
left 0 right9
100 height 1009
wochen zzgl einmalig9
von regulren preisen9
senkung der mwst9
high-speed-datenvolumens 216 mbits9
4 wochen zzgl9
euro 4 wochen9
startguthaben senkung der9
arial sans-serif sans-serif9
sans-serif sans-serif font-weight9
gbhigh-speed-internet inkl ltenbsp199
einmalig 1299 inkl9
10 startguthaben senkung9
inkl 10 startguthaben9
enthaltenen high-speed-datenvolumens 2169
1299 inkl 109
-moz-osx-font-smoothing grayscale font-size9
zzgl einmalig 12999
center media screen9
monate starter-set gratis8
eu-weite internet-flatrate mit8
gb high-speed-datenvolumen maximale8
text-align center media8
-webkit-box-orient vertical -webkit-box-direction8
footer links li8
0 top 08
whlen anderes smartphone8
100 max-width 1008
passendem smartphone zb8
4px 0 rgba08
mit passendem smartphone8
-ms-flex-direction column flex-direction8
display block position8
001e78 media screen8
2px 3px 10px8
3px 10px rgba08
wunsch mit passendem8
auf wunsch mit8
0 0 20px8
whlen auf wunsch8
column flex-direction column8
display block margin8
high-speed-datenvolumen maximale geschwindigkeit8
2px 4px 08
padding 0 10px8
0 0 58
normal -ms-flex-direction column8
deutschlands und im8
1 1 auto8
left media screen8
top 0 left8
display block width8
vertical -webkit-box-direction normal8
font-style normal font-weight7
0 0 color7
1 -ms-flex-order 07
background -webkit-gradientlinear left7
-ms-flex-order 0 order7
-webkit-gradientlinear left top7
left top left7
top left bottom7
aldi life musik7
life musik powered7
background linear-gradientto bottom7
margin 20px 07
powered by napster7
flex -webkit-box-orient vertical7
0 order 07
150ms ease transition7
padding 10px 40px7
fff text-decoration none7
2 order 27
-webkit-box-ordinal-group 1 -ms-flex-order7
-ms-flex-order 2 order7
3 -ms-flex-order 27
color 001e78 media7
eu-roaming inklusive produktdetails7
border-bottom 1px solid7
-webkit-box-ordinal-group 3 -ms-flex-order7
absolute left 07
sans-serif font-weight 4007
-ms-flex-positive 1 flex-grow6
position relative z-index6
1 -ms-flex-positive 16
-webkit-box-flex 1 -ms-flex-positive6
border 1px solid6
0 text-align center6
right 0 top6
margin-top 0 margin-bottom6
float left padding-right6
position absolute z-index6
center justify-content center6
left padding-right 5px6
aldi talk paket6
1 flex-grow 16
absolute top 06
-webkit-box-ordinal-group 4 -ms-flex-order6
position relative display6
text-align center text-decoration6
center text-decoration none6
-webkit-box-ordinal-group 2 -ms-flex-order6
-webkit-transform 150ms ease6
2 -ms-flex-order 16
font-weight 400 font-style6
-ms-flex-order 1 order6
transform 150ms ease6
sms innerhalb deutschlands6
0 2px 4px6
1 order 16
3 order 36
-ms-flex-order 3 order6
ease transition transform6
4 -ms-flex-order 36
400 font-style normal6
0 20px rgba06
-webkit-transform translatey-50 transform6
translatey-50 transform translatey-506
0 footer links6
min-width30em footer links6
001e78 font-weight 7006
color 001e78 font-weight6
20px rgba0 06
0 position relative6
10px 10px 05
-webkit-box-align center -ms-flex-align5
-ms-flex-align center align-items5
0 color 001e785
border-color eb5a0c color5
-ms-flex-pack center justify-content5
center -ms-flex-pack center5
nav-service tooltipflyout ul5
center align-items center5
center -ms-flex-align center5
position absolute right5
color fff padding5
text-decoration none line-height5
eb5a0c border-color eb5a0c5
absolute top 505
margin 0 padding5
display block media5
absolute width 1005
display noneimportant media5
noneimportant media screen5
box-shadow 0 05
0 4 box-shadow5
-webkit-box-shadow 0 05
flat unbegrenzte gesprche5
0 2 box-shadow5
block media screen5
gesprche und sms5
block margin 05
position absolute width5
mehrwert-dienste eu-weite internet-flatrate5
sondernr mehrwert-dienste eu-weite5
ohne sondernr mehrwert-dienste5
eu-ausland ohne sondernr5
im eu-ausland ohne5
gesprche sms innerhalb5
enthalten gesprche sms5
wochen enthalten gesprche5
text-align left media5
4 wochen enthalten5
screen and max-width619375em5
padding 10px 05
-webkit-box-pack center -ms-flex-pack5
scale1 transform scale15
-webkit-box-ordinal-group 7 -ms-flex-order5
50 max-width 505
0 50 max-width5
50 flex 05
0 50 flex5
4166667 max-width 41666675
6 -ms-flex-order 55
0 4166667 max-width5
4166667 flex 05
-ms-flex-order 5 order5
0 4166667 flex5
3333333 max-width 33333335
0 3333333 max-width5
3333333 flex 05
5 order 55
0 3333333 flex5
0 5833333 flex5
-webkit-box-ordinal-group 9 -ms-flex-order5
-webkit-box-ordinal-group 10 -ms-flex-order5
8 order 85
25 flex 05
0 9166667 max-width5
-ms-flex-order 8 order5
9 -ms-flex-order 85
7 order 75
25 max-width 255
-ms-flex-order 7 order5
8 -ms-flex-order 75
-webkit-box-ordinal-group 8 -ms-flex-order5
6 order 65
-ms-flex-order 6 order5
7 -ms-flex-order 65
-webkit-box-ordinal-group 6 -ms-flex-order5
4 order 45
-ms-flex-order 9 order5
0 75 flex5
0 100 flex5
100 flex 05
0 100 max-width5
-webkit-box-ordinal-group 0 -ms-flex-order5
9166667 flex 05
0 9166667 flex5
8333333 max-width 83333335
0 8333333 max-width5
8333333 flex 05
0 8333333 flex5
75 max-width 755
0 -ms-flex-order -15
0 75 max-width5
75 flex 05
6666667 max-width 66666675
-ms-flex-order 4 order5
14 -ms-flex-order 135
5 -ms-flex-order 45
5833333 flex 05
0 5833333 max-width5
-webkit-box-ordinal-group 5 -ms-flex-order5
13 order 135
-ms-flex-order 13 order5
5833333 max-width 58333335
-ms-flex-order -1 order5
0 6666667 flex5
-webkit-box-ordinal-group 14 -ms-flex-order5
-webkit-transform scale1 transform5
6666667 flex 05
-1 order -15
0 6666667 max-width5
10 -ms-flex-order 95
0 25 max-width5
9 order 95
auto flex 05
0 833333 max-width5
display block height5
833333 flex 05
screen and max-width299375em5
100 media screen5
0 833333 flex5
auto max-width none5
width auto max-width5
-webkit-box-ordinal-group 11 -ms-flex-order5
0 auto width5
border-top 1px solid5
833333 max-width 8333335
0 auto flex5
0 nav-service tooltipflyout5
1 max-width 1005
flex-grow 1 max-width5
0 -webkit-box-flex 15
screen and min-width8125em5
formatsvg font-face font-family5
flex-basis 0 -webkit-box-flex5
0 flex-basis 05
-ms-flex-preferred-size 0 flex-basis5
left 0 top5
0 display block5
auto width auto5
9166667 max-width 91666675
-webkit-box-ordinal-group 13 -ms-flex-order5
-ms-flex-order 10 order5
0 1666667 flex5
1666667 max-width 16666675
10 order 105
-webkit-box-ordinal-group 12 -ms-flex-order5
12 -ms-flex-order 115
11 -ms-flex-order 105
-ms-flex-order 11 order5
11 order 115
0 25 flex5
0 1666667 max-width5
-ms-flex-order 12 order5
1666667 flex 05
12 order 125
13 -ms-flex-order 125
position relative width4
hidden media screen4
tabsnavigation a font-size4
color 6s ease4
transition transform 2s4
none line-height 16px4
display none mm-menu4
margin 13px 04
ul li font-size4
color fff text-decoration4
0 navsubmenu submenulist4
background eb5a0c border-color4
0 0 1rem4
6s ease transition4
all 6s ease4
overflow hidden media4
-webkit-box-shadow 2px 3px4
product-slider slick-dots li4
0 5px 6px4
width 100 media4
5px 6px rgba04
2 box-shadow 2px4
transition transform 150ms4
box-shadow 2px 3px4
-webkit-transform translate0 -24px4
translate0 -24px transform4
-24px transform translate04
display block text-align4
transform translate0 -24px4
6px rgba0 04
100 height auto4
max-height 40px width4
bodynotcms-index-indexnotcheckout-index-index page-main bodynotcms-index-indexnotcheckout-index-index4
slider-nav-container slider-nav slick-dots4
block text-align center4
0 0 34
none box-shadow none4
eb5a0c color fff4
display none slick-slider--stage4
4 wochen enthlt4
wochen enthlt eu-weite4
none position absolute4
aldi talk musik-paket4
padding 20px 04
padding 0 40px4
img width 1004
nav-servicelogo-wrapper logologo--name span4
right media screen4
padding 0 20px4
0 20px 04
background fff color4
slick-slider slick-dots li4
margin-left 9166667 media4
anderes smartphone whlen4
0 0 30px4
padding 6px 70px4
0 margin 04
font-face font-family open4
10px color 001e784
text-align center display4
-webkit-transform rotate0 transform4
rotate0 transform rotate04
opacity 1 504
100 opacity 14
background fff border-radius4
block position absolute4
content display block4
opacity 3s ease4
normal text-transform none4
open sans font-style4
font-family iconfont sans-serif4
ease transition all4
display block padding4
300 font-style normal4
font-weight 300 font-style4
sans-serif font-weight 3004
src localopen sans4
sans font-style normal4
6px 70px 6px4
ease transition color4
font-weight 700 media4
ltenbsp19 eu-roaming inklusive4
700 media screen4
rgba255 255 2554
-webkit-box-shadow 0 2px4
box-shadow 0 2px4
color fff display4
border-radius 10px 10px4
10px 0 04
inklusive produktdetails produktinformationsblatt4
inkl ltenbsp19 eu-roaming4
-ms-flex-direction row flex-direction4
anderes smartphone internet-flatrate4
24 monate starter-set4
monatlaufzeit 24 monate4
0 2px 9px4
2px 9px 04
9px 0 rgba04
0 0 194
2s linear transition4
width 50px height4
row flex-direction row4
padding 0px 04
normal -ms-flex-direction row4
-webkit-box-flex 1 -ms-flex4
display inline-block width4
aldi talk basistarif4
block width 1004
zum aldi talk4
buchbar zum aldi4
601 und sms4
100 text-align center4
horizontal -webkit-box-direction normal4
display inline-block padding4
1 -ms-flex 14
-webkit-box-orient horizontal -webkit-box-direction4
-ms-flex 1 14
flex 1 14
auto flex 14
1 auto flex4
slick-arrow slick-slider slick-arrow3
2s -webkit-transform 2s3
product-slider slick-arrow slick-slider3
-webkit-box-shadow none box-shadow3
13px 0 padding3
slick-dots lislick-active button3
auto bottom 83
opacity 2s -webkit-transform3
block margin 13px3
top auto bottom3
15 media screen3
slick-dots li button3
relative display inline-block3
container usp-boxlist bodynotcms-index-indexnotcheckout-index-index3
tabsnavigation a spanclassutil-icon--3
verbrauchte inklusiveinheiten verfallen3
zu aldi talk3
fff padding 20px3
enthlt eu-weite internet-flatrate3
talk basistarif enthalten3
laufzeit 7 tage3
nicht verbrauchte inklusiveinheiten3
inklusiveinheiten verfallen am3
abzug gebracht internet-flatrate3
verfallen am laufzeitende3
nach ablauf gelten3
ablauf gelten die3
gelten die preise3
die preise gem3
preise gem roaming-preisliste3
gem roaming-preisliste unter3
musik-flat aldi life3
l whlen auf3
001e78 color fff3
nbsp nbsp nbsp3
tabsnavigation lihover background3
tarif-teaser btn font-size3
tarif-teasertitle text-wrapperbefore font-size3
tarif-teaserdetail padding 10px3
text-decoration none tooltipflyout3
background-repeat no-repeat background-size3
inkl ltenbsp19 flat3
12 monate starter-set3
ltenbsp19 flat unbegrenzte3
sms eu-roaming inklusive3
inklusive produktdetails zum3
produktdetails zum paket3
abzug gebracht paket3
m whlen auf3
monatlaufzeit 12 monate3
display block product-slider3
background rgba0 03
auto text-align left3
8125rem content important3
accordion--mobile accordiontrigger accordion--mobile3
0 text-align left3
accordiontrigger footerfootnote-law font-size3
accordiontitle accordiontrigger footerfootnote-law3
important top 503
content important top3
font-size 8125rem content3
position relative line-height3
6px 10px color3
70px 6px 10px3
ease transition -webkit-transform3
5s ease transition3
-webkit-transform 5s ease3
accordiontriggerafter footerfootnote-lawafter font-size3
accordiontrigger accordion--mobile footerfootnote-law3
usp-boxlist bodynotcms-index-indexnotcheckout-index-index page-main3
100 margin 03
background rgba255 2553
from5f77bf to001e78 background3
bottom from5f77bf to001e783
left bottom from5f77bf3
001e78 background -webkit-gradientlinear3
background 001e78 background3
font-weight 700 padding3
0 z-index 993
top 50 left3
0 bottom 03
solid 1px 0003
border solid 1px3
flex -webkit-box-orient horizontal3
80px media screen3
text-align center padding3
left 50 -webkit-transform3
padding 10px 20px3
block position relative3
linear-gradientto bottom 5f77bf3
border-right 1px solid3
none padding 03
p margin 03
0 list-style none3
auto media screen3
ccc media screen3
solid ccc media3
20px media screen3
margin 0 media3
auto padding 03
0 auto padding3
padding 0 03
border-box box-sizing border-box3
relative width 1003
10px padding-left 10px3
padding-right 10px padding-left3
padding 0 margin3
page-layout-2columns-left columnmain width3
0 auto text-align3
0 position absolute3
flex media screen3
display flex media3
float left media3
flex -webkit-box-align center3
display flex -webkit-box-align3
0 -webkit-transform rotate03
3s ease transition3
page-layout-2columns-left sidebar width3
util-icon--afterutil-icon--paket-phoneafter util-icon--beforeutil-icon--paket-phonebefore content3
display inline-block background3
width 100 display3
font-size 875rem line-height3
util-h3 h3 font-size3
normal font-weight 4003
font-family aldi sued3
to001e78 background linear-gradientto3
bottom 5f77bf 001e783
fff display block3
2 margin 03
absolute right 03
none navsubmenu submenulist3
bottom 0 left3
right 0 bottom3
li font-size 1125rem3
0 0 03
z-index 2 margin3
top 50 -webkit-transform3
eb5a0c z-index 23
solid eb5a0c z-index3
height 3px width3
-webkit-transform 2s linear3
padding 0 media3
padding 5px 03
position relative padding3
0 top 503
50 -webkit-transform translatey-503
40px width auto3
padding 20px 20px3
17px left 29px3
top 17px left3
font-weight 400 position3
3s ease-out transition3
-webkit-transform 3s ease-out3
20px 20px 20px3
logologo--name span font-size3
navsubmenu submenuteaser li3
margin 0 10px3
left 50 margin-left3
flex-direction column -webkit-box-pack3
li padding 10px3
padding 20px 40px3
50px height 50px3
1px solid 8da8b33
display inline-block height3
20px margin-bottom 20px3
font-size 8125rem display3
text-transform none white-space3
btn-group--inline li btn-group--right3
btn-group--centered li btn-group--inline3
btn-group li btn-group--centered3
nowrap margin 03
white-space nowrap margin3
none white-space nowrap3
letter-spacing normal text-transform3
li display inline-block3
400 letter-spacing normal3
font-weight 400 letter-spacing3
23 font-weight 4003
line-height 23 font-weight3
border solid 2px3
125rem border solid3
font-size 125rem border3
lilast-child margin-bottom 03
footer links title3
0 margin-bottom 20px3
font-size 1rem media3
4 box-shadow 03
text-decoration none -webkit-box-shadow3
border-radius 10px padding3
background fff text-decoration3
table caption font-size3
1rem media screen3
td th font-size3
li a font-size3
table td th3
translate0 -24px color3
background fff padding3
40px media screen3
none margin 03
padding 0 footer3
li a padding3
roaming-preisliste unter wwwalditalkde3
0 0227
media screen184
display block107
0 -ms-flex67
-webkit-box-flex 067
flex 065
-ms-flex 065
margin 064
position absolute62
position relative60
padding 059
text-align center51
width 10050
display none48
rgba0 045
display inline-block43
color fff43
color 001e7839
aldi talk37
overflow hidden37
padding 10px32
text-decoration none31
line-height 030
font-size 029
left 029
height 029
font-weight 70029
display flex28
clear both27
display -ms-flexbox27
-webkit-box display27
0 overflow27
display -webkit-box27
-ms-flexbox display27
0 line-height26
font-weight 40026
0 height26
block content25
both font-size24
content clear24
background fff23
1px solid23
font-size 1rem23
absolute top23
0 auto23
padding 20px22
text-align left22
top 022
4 wochen22
mbits im22
bis zum21
ease transition21
font-style normal20
footer links20
right 019
width auto18
0 media18
background 017
0 padding17
20px 017
0 20px17
font-size 8125rem17
height 10017
margin-bottom 20px16
font-family open16
opacity 116
max-width 10016
open sans16
margin-bottom 016
none media15
0 top15
font-size 1125rem15
100 height15
top 5015
0 rgba014
border-radius 10px14
0 10px14
float left14
white-space nowrap14
font-size 125rem14
transition transform14
150ms ease14
sans-serif font-weight13
0 2px13
height auto13
arial sans-serif13
-webkit-box-direction normal12
10px 012
zum ende12
-webkit-box-shadow 012
padding 5px12
normal -ms-flex-direction12
box-shadow 012
outline 012
antialiased -moz-osx-font-smoothing12
0 right12
display noneimportant12
cursor pointer12
sans arial12
216 mbits12
speak none12
solid ccc12
-webkit-font-smoothing antialiased12
0 left12
-moz-osx-font-smoothing grayscale12
0 10012
0 color11
normal speak11
0 product-slider11
absolute left11
2s linear11
none -webkit-font-smoothing11
im upload11
im download11
ende des11
left 5011
86 mbits11
margin-top 011
content position11
0 211
background 001e7811
product-slider slider-nav-container11
des im10
im tarif10
flex -webkit-box-orient10
verbrauch des10
geschwindigkeit bis10
maximale geschwindigkeit10
automatisch von10
10px rgba010
zum verbrauch10
font-size 15rem10
tarif enthaltenen10
0 text-align10
2px 4px10
upload danach10
abzug gebracht10
0 position10
danach bis10
des jew10
jew abrechnungszeitraums10
abrechnungszeitraums max10
max 5610
56 kbits10
background eb5a0c10
inkl 1010
aldi life10
slick-dots li10
-webkit-box-flex 110
menu-main li10
0 583333310
0 166666710
0 666666710
0 83333310
0 410
0 833333310
0 7510
0 2510
0 333333310
0 916666710
header headersticky10
0 5010
slider-nav-container slider-nav10
0 416666710
navsubmenu submenulist10
inkl ltenbsp199
regulren preisen9
im eu-ausland9
gbhigh-speed-internet inkl9
sans-serif sans-serif9
grayscale font-size9
bottom 09
auto flex9
gb high-speed-datenvolumen9
center media9
von regulren9
high-speed-datenvolumens 2169
0 59
euro 49
wochen zzgl9
zzgl einmalig9
einmalig 12999
1299 inkl9
wird automatisch9
border none9
10 startguthaben9
enthaltenen high-speed-datenvolumens9
startguthaben senkung9
mwst wird9
der mwst9
senkung der9
100 max-width9
4px 08
passendem smartphone8
smartphone zb8
2px 3px8
3px 10px8
list-style none8
block position8
starter-set gratis8
nav-service tooltipflyout8
margin 20px8
whlen anderes8
monate starter-set8
flex-direction column8
anderes smartphone8
links li8
3s ease8
-ms-flex-direction column8
0 5px8
innerhalb deutschlands8
height 50px8
font-size 875rem8
15px 08
font-size 1375rem8
high-speed-datenvolumen maximale8
font-face font-family8
block width8
6s ease8
internet-flatrate mit8
eu-weite internet-flatrate8
1 18
1 auto8
column flex-direction8
padding 6px8
span font-size8
block margin8
fff padding8
20px 20px8
ul li8
mit passendem8
translate0 -24px8
50 -webkit-transform8
text-decoration underline8
color 4a4a4a8
auto width8
001e78 media8
footerlinklist li8
whlen auf8
wunsch mit8
auf wunsch8
float right8
left media8
0 display8
-webkit-box-orient vertical8
vertical -webkit-box-direction8
10px 40px7
normal font-weight7
eu-roaming inklusive7
-webkit-transform translate07
order 07
font-size 1875rem7
paket l7
z-index 27
opacity 07
margin-left 07
img width7
font-size 75rem7
bodynotcms-index-indexnotcheckout-index-index page-main7
-webkit-transition all7
inklusive produktdetails7
border-bottom 1px7
transition all7
life musik7
padding-right 5px7
color 5252527
transform translate07
left top7
3 -ms-flex-order7
-webkit-box-ordinal-group 17
-ms-flex-order 07
linear-gradientto bottom7
background linear-gradientto7
left bottom7
top left7
-webkit-gradientlinear left7
2 order7
background -webkit-gradientlinear7
0 order7
musik powered7
max-width none7
auto max-width7
0 40px7
-webkit-box-ordinal-group 37
-ms-flex-order 27
1 -ms-flex-order7
fff text-decoration7
tooltipflyout ul7
10px 20px7
content display7
10px 10px7
margin-bottom 40px7
order 27
flex-grow 16
slick-slider slick-dots6
sms innerhalb6
1 flex-grow6
25 max-width6
nav-servicelogo-wrapper logologo--name6
product-slider slick-dots6
-webkit-transition -webkit-transform6
-ms-flex-positive 16
talk paket6
none line-height6
absolute z-index6
left auto6
0 -webkit-box-flex6
z-index 16
justify-content center6
center justify-content6
relative z-index6
align-items center6
transform translatey-506
relative display6
center text-decoration6
1 -ms-flex-positive6
enthalten gesprche6
translatey-50 transform6
transition -webkit-transform6
-webkit-transform translatey-506
0 z-index6
sondernr mehrwert-dienste6
3 order6
-webkit-box-ordinal-group 46
0 bottom6
border 1px6
left padding-right6
-webkit-box-ordinal-group 26
2 -ms-flex-order6
-ms-flex-order 16
1 order6
order 16
media min-width768px6
border solid6
4 -ms-flex-order6
-ms-flex-order 36
font-family iconfont6
order 36
paket m6
5px 06
form--transition formfield-wrapperis-invalid6
-webkit-transform 150ms6
transform 150ms6
20px rgba06
400 font-style6
eb5a0c color6
0 margin-bottom6
min-width30em footer6
001e78 font-weight6
line-height 156
0 footer6
ease-out transition6
-webkit-transform 2s6
tabsnavigation li6
border-color eb5a0c6
margin-right 10px6
max-width 756
font-weight 3006
tarif-teasertitle text-wrapper6
eb5a0c border-color5
3s ease-out5
block height5
produktdetails zum5
color 9d9d9d5
flat unbegrenzte5
color 9995
fr die5
li display5
musik-paket l5
255 2555
block media5
background rgba05
text-align right5
color eb5a0c5
unbegrenzte gesprche5
top auto5
linear transition5
10px color5
absolute width5
4 box-shadow5
none mm-menu5
absolute right5
mm-menu mm-listview5
0 navsubmenu5
font-size 9375rem5
footerfootnote-law font-size5
li font-size5
vertical-align middle5
tabsnavigation lihover5
padding 15px5
5s ease5
box-shadow 2px5
musik-paket m5
2 box-shadow5
-webkit-box-shadow 2px5
20px 40px5
0 nav-service5
paket s5
slider-nav slick-dots5
display inlineimportant5
display blockimportant5
noneimportant media5
nav-servicelogo-wrapper logo5
right 10px5
width 05
-webkit-box-align center5
10 order5
40px 05
4 order5
order 45
enthlt eu-weite5
border-top 1px5
-webkit-box-ordinal-group 65
6 -ms-flex-order5
background ffba005
padding 40px5
5 -ms-flex-order5
-ms-flex-order 55
wrapper padding5
5 order5
order 55
-webkit-box-ordinal-group 75
100 media5
7 -ms-flex-order5
-ms-flex-order 45
none padding5
fff color5
-ms-flex-order -15
9166667 flex5
footer title5
9166667 max-width5
8 order5
100 flex5
-webkit-box-ordinal-group 05
0 -ms-flex-order5
-1 order5
-webkit-box-ordinal-group 55
order -15
-webkit-box-ordinal-group 145
14 -ms-flex-order5
formatsvg font-face5
-ms-flex-order 135
13 order5
0 margin5
order 135
-ms-flex-order 65
6 order5
8333333 max-width5
-ms-flex-order 105
11 order5
-ms-flex-order 115
12 -ms-flex-order5
order 75
-webkit-box-ordinal-group 125
order 105
-webkit-box-ordinal-group 95
11 -ms-flex-order5
-webkit-box-ordinal-group 135
-webkit-box-ordinal-group 115
order 95
9 order5
-ms-flex-order 95
10 -ms-flex-order5
-webkit-box-ordinal-group 105
order 85
9 -ms-flex-order5
order 115
13 -ms-flex-order5
order 65
margin-left 66666675
-webkit-box-ordinal-group 85
8 -ms-flex-order5
-ms-flex-order 75
margin-left 91666675
margin-left 83333335
margin-left 755
7 order5
margin-left 58333335
-ms-flex-order 125
margin-left 505
margin-left 41666675
margin-left 33333335
margin-left 255
margin-left 16666675
margin-left 8333335
order 125
12 order5
max-width 83333335
max-width 91666675
8333333 flex5
gesprche sms5
0 -webkit-transform5
pointer-events none5
max-width 16666675
fff border-radius5
0 background5
wochen enthalten5
25 flex5
scale1 transform5
max-width 255
3333333 flex5
ohne sondernr5
3333333 max-width5
max-width 33333335
4166667 flex5
mehrwert-dienste eu-weite5
-webkit-transform scale15
transform scale15
4166667 max-width5
center -ms-flex-align5
padding-left 05
-ms-flex-pack center5
center -ms-flex-pack5
-webkit-box-pack center5
center align-items5
-ms-flex-align center5
-ms-flex-preferred-size 05
1666667 max-width5
0 flex-basis5
flex-basis 05
1 max-width5
833333 flex5
833333 max-width5
max-width 8333335
1666667 flex5
color ff41415
eu-ausland ohne5
max-width 41666675
50 flex5
75 max-width5
75 flex5
max-width 66666675
6666667 max-width5
6666667 flex5
max-width 58333335
5833333 max-width5
5833333 flex5
max-width 505
50 max-width5
10px padding5
-ms-flex-order 85
all 6s4
list ul4
tabsnavigation liactive4
-24px transform4
max-height 40px4
40px width4
opacity 2s4
form--transition formfield-wrapper4
margin-top 10px4
product-slider padding4
page-main bodynotcms-index-indexnotcheckout-index-index4
logologo--name span4
relative width4
color 6s4
navsubmenu submenuteaser4
5px media4
margin 5px4
hidden media4
margin 13px4
transform 2s4
tarif-teasertitle text-wrapperbefore4
0 border-radius4
none slick-slider--stage4
slick-slider--stage slick-list4
price-box--big current-price--monthly4
font-size 25rem4
auto bottom4
10px border4
left 10px4
z-index 04
nbsp nbsp4
2px solid4
6px rgba04
0 34
margin-top 20px4
mm-opening mobile-menu-toggle4
menu-main lihighlight4
internet-flatrate s4
internet-flatrate m4
internet-flatrate l4
0 0important4
solid 8da8b34
background f4f4f44
left 29px4
offer-teaserlist ul4
13px 04
2s transition4
width 50px4
um die4
min-width30em tabsnavigation4
zu den4
50px height4
table tr4
menu-main liactive4
5px 6px4
inline-block padding4
font-size 375rem4
line-height 16px4
background 004b9c4
2s -webkit-transform4
right media4
100 -webkit-transform4
no-repeat background-size4
padding 0px4
iconfont sans-serif4
sup font-size4
block padding4
700 media4
100 display4
visibility hidden4
visibility visible4
font-size 175rem4
util-h3 h34
2s ease4
motorola edge4
inline-block width4
6px 10px4
footerfootnote-lawafter right4
buchbar zum4
40px media4
produktdetails produktinformationsblatt4
ltenbsp19 eu-roaming4
smartphone internet-flatrate4
300 font-style4
localopen sans4
24 monate4
monatlaufzeit 244
-webkit-transform rotate04
100 text-align4
normal text-transform4
100 opacity4
src localopen4
content important4
rotate0 transform4
border-radius 04
talk basistarif4
infinite linear4
accordiontrigger footerfootnote-law4
-webkit-transition color4
transition color4
none width4
100 margin4
von aldi4
transform rotate04
footerfootnote-lawafter font-size4
0 opacity4
70px 6px4
opacity 3s4
1 504
util-icon--beforeutil-icon--paket-phonebefore content4
10px width4
ease -webkit-transform4
margin 10px4
center display4
euro nbsp4
0 30px4
0px 04
text-transform none4
6px 70px4
zum aldi4
util-only-mobile display4
translate-50 -504
eb5a0c background4
fff display4
border-color ff41414
wochen enthlt4
0 width4
none position4
z-index 994
rgba255 2554
color 2s4
0 194
-webkit-box-shadow none4
50 margin-left4
none box-shadow4
box-shadow none4
auto media4
talk musik-paket4
9px 04
001e78 background4
2px 9px4
auto padding4
auto text-align4
smartphone whlen4
9166667 media4
btn font-size4
util-no-mobile display4
flex 14
-webkit-box-orient horizontal4
block text-align4
float none4
1 -ms-flex4
horizontal -webkit-box-direction4
line-height 234
translate3d0 04
-ms-flex 14
-ms-flex-direction row4
color fffimportant4
2px 10px4
btn-group--inline li4
0 1rem4
row flex-direction4
flex-direction row4
sans font-style4
none display3
gem roaming-preisliste3
roaming-preisliste unter3
preise gem3
ist die3
die preise3
auto right3
gelten die3
bei der3
position static3
am laufzeitende3
15 media3
product-slider slick-arrowbefore3
verfallen am3
bei aldi3
product-slider slider-nav3
ablauf gelten3
0 slick-slider--stage3
button height3
lislick-active button3
bottom 83
slick-dots lislick-active3
nach ablauf3
li button3
sms eu-roaming3
musik-flat aldi3
0 -webkit-box-shadow3
laufzeit 73
promotionbtn font-size3
m whlen3
background-repeat no-repeat3
l 9993
24 stunden3
basistarif enthalten3
u schweiz3
internet-flatrate xl3
form--personal-data tooltip3
gebracht paket3
7 tage3
nicht verbrauchte3
verbrauchte inklusiveinheiten3
inklusiveinheiten verfallen3
zum paket3
ltenbsp19 flat3
min-width30em offer-teaserflag3
0 15px3
zu aldi3
tarif-teaser btn3
knnen sie3
7 gb3
stepsitem h43
spanclassutil-icon-- font-size3
001e78 color3
lihover background3
001e78 tabsnavigation3
samsung galaxy3
0 tooltipflyout3
nokia 133
text-wrapperbefore font-size3
gebracht internet-flatrate3
tarif-teaserdetail padding3
l whlen3
none tooltipflyout3
12 monate3
monatlaufzeit 123
slick-slider slick-arrowbefore3
color 002c5c3
slick-slider slick-arrow3
margin-bottom 20pximportant3
4s transition3
-webkit-transform 4s3
-webkit-transform 5s3
right 20px3
accordiontriggerafter footerfootnote-lawafter3
20px text-align3
border-radius 5px3
top -3px3
margin-bottom 40pximportant3
margin-bottom 10pximportant3
30px 03
margin-bottom 0important3
margin-top 0important3
padding-top 0important3
flex media3
flex -webkit-box-align3
opacity 53
100 left3
5px solid3
linear animation3
height 80px3
line-height 14em3
8125rem content3
border-radius 503
center padding3
background rgba2553
none -webkit-transition3
position fixed3
border-color 54ca8e3
10px margin-bottom3
1px 0003
solid 1px3
80px media3
z-index 33
50 left3
important top3
infoboximg-wrapper img-text--absolute3
1 media3
relative line-height3
20px color3
footerfootnote-law padding3
right 40px3
accordion--mobile footerfootnote-law3
accordiontrigger accordion--mobile3
accordion--mobile accordiontrigger3
accordiontitle accordiontrigger3
50 font-size3
transition opacity3
100 border-radius3
border-box box-sizing3
p margin3
0 list-style3
0 border3
background e2e2e23
ccc media3
border-right 1px3
20px media3
line-height 143
box-sizing border-box3
-webkit-box-sizing border-box3
columnmain width3
media min-width992px3
10px media3
padding-right 03
margin-left auto3
margin-right auto3
padding-left 10px3
10px padding-left3
padding-right 10px3
usp-boxlist bodynotcms-index-indexnotcheckout-index-index3
container usp-boxlist3
page-layout-2columns-left columnmain3
page-layout-2columns-left sidebar3
-webkit-transition opacity3
tarif-change font-size3
color 54ca8e3
util-icon--beforeutil-icon--musicbefore content3
util-icon--beforeutil-icon--wwwbefore content3
util-icon--afterutil-icon--paket-phoneafter util-icon--beforeutil-icon--paket-phonebefore3
height 20px3
width 20px3
border-radius 50px3
inline-block background3
line-height 13
20px background3
sidebar width3
875rem line-height3
letter-spacing 6px3
h3 font-size3
util-h2 h23
font-size 2375rem3
util-h1 h13
font-weight 8003
aldi sued3
font-family aldi3
width 353
700 padding3
bottom from5f77bf3
slick-arrow slick-slider3
padding-bottom 20px3
submenuteaser li3
none navsubmenu3
z-index 113
10px border-radius3
right 153
span color3
0 4px3
padding 30px3
li span3
mmenufixedhint-list display3
-webkit-transform translate3d03
hint-listitembefore font-size3
2 margin3
eb5a0c z-index3
solid eb5a0c3
top 8px3
3px width3
height 3px3
relative padding3
inline-block height3
20px margin-bottom3
0 mm-menu3
transform translate3d03
caption font-size3
price-box taxes3
product-slider slick-arrow3
product-slider slick-slide3
slick-slider slick-track3
product-slider slick-track3
block product-slider3
0 103
20px left3
top 20px3
tooltip price-box3
price-box old-price3
li padding3
current-price--monthly font-size3
17px left3
top 17px3
0 font-size3
padding 2px3
400 position3
-webkit-transform 3s3
min-width62em nav-servicelogo-wrapper3
column -webkit-box-pack3
white-space normal3
none -webkit-box-shadow3
table caption3
from5f77bf to001e783
0 border-color3
title footer3
lilast-child margin-bottom3
btn-group--right li3
li btn-group--right3
li btn-group--inline3
btn-group--centered li3
li btn-group--centered3
btn-group li3
margin-left 10px3
nowrap margin3
ul display3
none white-space3
letter-spacing normal3
400 letter-spacing3
23 font-weight3
solid 2px3
125rem border3
8125rem display3
5f77bf 001e783
bottom 5f77bf3
to001e78 background3
links title3
li ahover3
1rem media3
border-radius 1003
th font-size3
td th3
table td3
10px left3
form--transition formfield-wrapperis-valid3
-24px color3
selectformlabel form--transition3
inputnottypecheckboxnottyperadioformlabel form--transition3
10px right3
ff4141 formfield-wrapperis-invalid3
top 2px3
none margin3
height 30px3
form inputtyperadiolabelbefore3
form inputtyperadiolabelafter3
form textarea3
footer-checkoutcontent ul3
10px text-align3
5px 40px3
footerfootnote text-align3
img display3
center width3
unter wwwalditalkde3
01022
display304
media207
font-size200
screen184
padding162
none162
color147
width133
left132
10px130
position128
1121
20px115
background115
height110
block107
margin102
flex99
margin-left97
max-width96
top95
293
center90
content88
auto87
-ms-flex-order81
-webkit-box-ordinal-group81
order81
text-align80
fff78
-webkit-box-flex77
-webkit-transform73
line-height73
-ms-flex71
transform70
li69
right66
font-weight66
margin-bottom64
absolute62
360
min-width48em60
relative60
5px56
001e7856
product-slider54
aldi54
452
min-width62em52
40px52
2px48
rgba047
im46
bottom46
545
ease43
form43
inline-block43
min-width30em42
transition41
hidden41
normal41
solid40
text-decoration40
border-radius39
zum38
overflow38
z-index38
opacity38
talk38
die38
slick-slider38
margin-top36
635
1px34
0important34
734
833
footer30
internet-flatrate30
eb5a0c30
der30
-webkit-transition29
border-color29
929
tabsnavigation29
1rem28
-webkit-box27
-ms-flexbox27
clear27
both27
1027
form--transition26
float26
font-family26
1126
2s26
sans-serif26
1226
mit25
border25
padding-left25
des25
margin-right25
-webkit-box-shadow24
padding-right24
50px24
box-shadow24
inkl24
wochen23
bis23
mm-menu23
ul23
tooltipflyout23
30px23
1323
mbits23
6px22
1422
1522
paket22
menu-main21
3px21
font-style21
1620
1720
euro20
1820
1920
sans20
2020
2120
2220
20pximportant20
2320
2420
l20
von20
whlen20
links20
40pximportant20
10pximportant20
2519
2619
linear19
cursor19
smartphone18
max-height18
ccc17
sms17
8125rem17
slick-dots17
ist17
white-space17
slick-slider--stage17
span17
navsubmenu16
row16
column16
2716
img16
m16
src16
open16
125rem15
padding-top15
1125rem15
4px15
price-box15
2815
all14
nowrap14
padding-bottom14
bodynotcms-index-indexnotcheckout-index-index14
tooltip14
border-bottom14
15px14
footerlinklist14
noneimportant14
translate014
outline14
150ms14
geschwindigkeit13
80px13
header13
formfield-wrapperis-invalid13
tarif13
background-color13
musik-paket13
table13
3s13
s13
nav-servicelogo-wrapper13
bei13
fr13
arial13
slider-nav13
flex-direction12
-webkit-font-smoothing12
2912
3012
3112
gesprche12
accordion--mobile12
speak12
pointer12
antialiased12
footerfootnote-law12
-moz-osx-font-smoothing12
grayscale12
translatey-5012
jew12
tarif-teasertitle12
justify-content12
-webkit-box-orient12
-webkit-box-direction12
-ms-flex-direction12
nav-service12
3212
download12
auf12
letter-spacing12
ende12
liactive12
title12
page-main12
-ms-flex-pack11
slider-nav-container11
automatisch11
zu11
wird11
60px11
nbsp11
upload11
footerfootnote-lawafter11
eu-ausland11
abzug11
gb11
preisen11
visibility11
transparent11
ease-out11
starter-set11
high-speed-datenvolumen11
3311
formfield-wrapperis-valid11
btn-group--inline10
abrechnungszeitraums10
3410
btn-group10
max10
btn-group--right10
btn-group--centered10
slick-sliderinfo-wrapper10
life10
musik10
usp-boxlist10
tarif-teaser10
danach10
border-box10
eu-weite10
maximale10
formfield-wrapper10
verbrauch10
3510
enthaltenen10
enthalten10
regulren10
headersticky10
button10
startguthaben10
3610
border-top10
ului-autocomplete10
16px10
scale110
kbits10
vertical-align10
p10
gebracht10
mobile-menu-toggle10
submenulist10
3710
15rem10
napster9
slick-slide9
tooltip--form9
zzgl9
slick-arrow9
einmalig9
ltenbsp199
mwst9
ff41419
senkung9
gbhigh-speed-internet9
high-speed-datenvolumens9
h39
den9
-10px9
12px9
oder9
innerhalb9
5s9
100px9
produktdetails9
-webkit-box-pack9
ab9
-24px9
max-width479375em9
price-box--big9
produktinformationsblatt9
lilast-child9
vertical8
ffba008
1375rem8
wunsch8
passendem8
388
laufzeit8
formatsvg8
footerpayment8
translate3d08
btn8
4a4a4a8
underline8
formattruetype8
gratis8
formatwoff8
deutschlands8
slick-arrowbefore8
6s8
zb8
wrapper8
rotate08
important8
font-face8
formatembedded-opentype8
anderes8
formatwoff28
hint-list--small8
textarea8
monatlaufzeit8
slick-list8
list-style8
monate8
875rem8
powered7
select7
nicht7
slick-track7
offer-teaserflag7
eu-roaming7
linear-gradientto7
ohne7
hint-list7
397
inklusive7
accordiontrigger7
75rem7
align-items7
1875rem7
container7
-webkit-gradientlinear7
407
sie7
mm-opening6
search-layercontent6
background-size6
footersender6
-40px6
-webkit-box-align6
8px6
-ms-flex-align6
text-wrapper6
max-width299375em6
416
tarif-teaserdetail6
list6
mobile6
jederzeit6
54ca8e6
active6
ffce4d6
text-transform6
page-layout-2columns-left6
iconfont6
22px6
9px6
offer-teaserbtn6
h46
logologo--name6
h26
fffimportant6
prepaid6
f4f4f46
footer-checkoutcontent6
0px6
25s6
0006
flat6
inputnottypecheckboxnottyperadio6
9d9d9d6
ber6
buchbar6
um6
u6
flex-basis6
mehrwert-dienste6
das6
unbegrenzte6
stretch6
-ms-flex-preferred-size6
sondernr6
ahover6
-3px6
per6
stepsitem6
min-width768px6
426
70px6
flex-grow6
-ms-flex-positive6
slick-slider--teaser6
sich6
min-height5
sued5
nav-serviceright5
klarna5
435
min-width8125em5
current-price--monthly5
wwwalditalkde5
13px5
keine5
dem5
inklusiveinheiten5
search-layer5
tabstext5
lihover5
motorola5
knnen5
min-width5
logo5
spanafter5
stepsitemafter5
gelten5
justify5
max-width619375em5
th5
blockimportant5
inlineimportant5
accordiontriggerafter5
004b9c5
4s5
selectformlabel5
lifirst-child5
accordiontitle5
visible5
formerror5
infoboximg-wrapper5
445
f6901b5
footersender-logos5
footerpayment-logos5
offer-teaserlist5
19px5
preise5
middle5
keyframes5
9375rem5
enthlt5
stage5
mm-listview5
pointer-events5
-webkit-keyframes5
hint-listlist5
h65
offer-teaserimage5
tarif-change5
guthaben4
usp-boxlist-item4
ihren4
454
tooltipflyoutbefore4
promotionbtn4
tooltipflyoutafter4
eine4
375rem4
edge4
tabstexthover4
border-width4
kachel3container4
galaxy4
fadein4
amp4
text-wrapperbefore4
usp-boxseals4
unter4
270px4
horizontal4
rotate360deg4
opacityloader4
15s4
no-repeat4
util-no-mobile4
util-only-mobile4
img-text--absolute4
translate-504
464
highlightloader4
rgba2554
-o-box-shadow4
-ms-box-shadow4
0deg4
474
484
buttonlast-child4
kann4
footerfootnote-logos4
scale754
animation4
1s4
luxembourg4
min-width480px4
gem4
laufzeitende4
-5px4
e2e2e24
localopen4
wwwaldilifecom4
h14
erforderl4
infinite4
util-h34
175rem4
highlighted4
sup4
util-icon--afterutil-icon--paket-phoneafter4
util-icon--beforeutil-icon--paket-phonebefore4
datenverbindungen4
-webkit-animation4
spinnerloder4
basistarif4
alast-child4
inputnottypecheckboxnottyperadioformlabel4
am4
8da8b34
htmlmm-opening4
nav-servicetext4
jeweils4
erfolgt4
textareaformlabel4
35px4
25rem4
lihighlight4
search-layerimage4
werden4
tarifoptionen4
slick-trackafter4
slick-arrowfocus4
slick-arrowhover4
telefonieren4
submenuteaser4
footerfootnotecontent-hidden4
scalex14
datenverbindung4
21px4
29px4
td4
tr4
abefore4
headersticky-sticky-wrapperis-sticky4
24px4
ease-in-out4
nav-serviceullia4
hint-listitem4
494
nach4
schweiz3
roaming-preisliste3
moto3
infos3
ablauf3
weitere3
pro3
alle3
aus3
verfallen3
verbrauchte3
leistungserbringer3
tage3
internetverbindung3
schweden3
nutzung3
wenn3
vom3
eps3
luxemburg3
angegebenen3
auch3
diese3
503
sind3
ratenkauf3
agb3
mglich3
stunden3
datalayer3
musik-flat3
5f77bf3
14em3
accordioncontent-hidden3
002c5c3
infoboximg-wrapperafter3
f4b8003
fixed3
badge3
from5f77bf3
to001e783
btn--ghost3
red3
btn--secondary3
btnhover3
-8px3
footerborder--desktop3
footerfootnote3
25px3
43px3
-9999px3
inputtyperadiolabelafter3
inputtyperadiolabelbefore3
background-image3
util-show-grid3
inputtyperadioformerror3
sidebar3
mein3
min-width992px3
-webkit-box-sizing3
box-sizing3
border-right3
tabs3
e8e8e83
block-servicelayer3
columnmain3
regular3
text-indent3
513
util-h13
2375rem3
util-h23
7px3
util-icon--only3
util-icon--afterutil-icon--wwwafter3
util-icon--beforeutil-icon--wwwbefore3
util-icon--afterutil-icon--musicafter3
util-icon--beforeutil-icon--musicbefore3
inputtypecheckboxformerror3
caption3
samsung3
usp-boxbenefits3
slick-listdragging3
slick-arrowslick-hidden3
lislick-active3
static3
523
spanclassutil-icon--3
tooltiptrigger3
tarif-teaser--detail3
form--personal-data3
offer-teaser3
align-self3
stageteaser3
rechtespalte3
background-repeat3
smartphonecontainer3
tablets3
xl3
smartphones3
registrierung3
alcatel3
nokia3
search-layerimagea3
-ms-flex-item-align3
e9f6ff3
500px3
baseline3
hint-listitembefore3
hint-list--mobile3
mmenufixedhint-list3
libefore3
list--tarif3
mm-navbar3
nav-serviceulli3
nav-serviceulliais-activeafter3
scaley13
product-teaser--image-only3
1em3
150px3
17px3
36px3
14px3
sim-boxnav-servicesim-anchor3
current-price3
old-price3
taxes3
product-teaserimage3
util-h-xs3

Who hosts Alditalk.de?

Alditalk.de Hosting Provider Information

Hosted IP Address:62.180.131.138
Hosted Hostname:62-180-131-138.business.static.de.bt.net
Service Provider:British Telecommunications plc
Hosted Country:GermanyDE
Location Latitude:51.4627
Location Longitude:7.0748
Webserver Software:Apache

Is "British Telecommunications plc" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%
British Telecommunications PLC
0.0547%

HTTP Header Analysis for Alditalk.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Apache
X-FRAME-OPTIONS: SAMEORIGIN
X-CONTENT-TYPE-OPTIONS: NOSNIFF
Strict-Transport-Security: max-age=10886400; includeSubdomains
Access-Control-Allow-Origin: https://medion01.webtrekk.net
Access-Control-Request-Method: GET
Access-Control-Allow-Credentials: false
Content-Language: de
Content-Encoding: gzip
X-XSS-Protection: 1; mode=block
Content-Type: text/html;charset=UTF-8
Content-Length: 39751
Date: Tue, 13 Oct 2020 02:54:56 GMT
Connection: keep-alive
Vary: Accept-Encoding

Alditalk.de Domain Nameserver Information

HostIP AddressCountry
ns.domainnetwork.se 156.154.130.100
ns2.domainnetwork.se 156.154.130.100
ns3.domainnetwork.com 156.154.131.100


Need to find out who hosts Alditalk.de?


Domain Registration (WhoIs) information for Alditalk.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: alditalk.de
Nserver: ns.domainnetwork.se
Nserver: ns2.domainnetwork.se
Nserver: ns3.domainnetwork.com
Status: connect
Changed: 2018-07-18T17:07:12+02:00

Websites with Similar Names

Alditalk.be
MEDION.BE Online Shop | Computer, Elektronik & Multimedia
Alditalk.de
Prepaid surfen, telefonieren, & günstige Smartphones | ALDI TALK
Aldith.com
HugeDomains.com - Shop for over 300,000 Premium Domains

Recently Updated Websites

Wastefavo.space (1 second ago.)Kaput.today (2 seconds ago.)News-net.london (3 seconds ago.)Amsterlive.icu (4 seconds ago.)Dennisgatz.com (4 seconds ago.)Privacy.healthcare (4 seconds ago.)Gogi.monster (5 seconds ago.)Kylin.club (6 seconds ago.)Weekendonthewaysin.site (6 seconds ago.)Hotalinginsuranceservices.club (6 seconds ago.)Fahrschule-snopek.at (7 seconds ago.)Studhalter.group (7 seconds ago.)Alexendra.com (8 seconds ago.)Vuzotq.site (8 seconds ago.)Letgolf.live (8 seconds ago.)Chline.com (10 seconds ago.)Cosedicucina.it (11 seconds ago.)Sa14b.live (11 seconds ago.)Bitunitiro.site (12 seconds ago.)United-airlines.ch (14 seconds ago.)Mailforwarder.icu (14 seconds ago.)Imakesrsulefosot.club (14 seconds ago.)Stasneyrenovations.com (15 seconds ago.)Asoh.life (15 seconds ago.)Toidaybaby.live (15 seconds ago.)Codinglabs.io (15 seconds ago.)Sechsmemphis.com (16 seconds ago.)Comdia.com (17 seconds ago.)Wizzfashion.site (17 seconds ago.)Fawkesten.club (18 seconds ago.)

Recently Searched Keywords

costa blanca (2 seconds ago.)tangerangdigital (3 seconds ago.)thch thm (8 seconds ago.)000000 important (8 seconds ago.)thm vo (15 seconds ago.)155 214 100 (15 seconds ago.)button-17024-127 (19 seconds ago.)des (20 seconds ago.)menu three horizontal (24 seconds ago.)239 100 1279e7 (24 seconds ago.)news media (27 seconds ago.)koruna cayman islands (28 seconds ago.)《公審》閩劇簡譜 (33 seconds ago.)contact (36 seconds ago.)hawraman iraq (39 seconds ago.)indian rupee (41 seconds ago.)【モヤさま】稲城市の梨そばの店の場所や珍獣牧場、公園の場所はココ!ロケの目撃情報は? (48 seconds ago.)sprzä…tanie dunajca 22 marca 2014-relacja (49 seconds ago.)gifts, clothing, & more (55 seconds ago.)fl-heading-text (1 minute 1 second ago.)devon (1 minute 21 seconds ago.)border-stylesolidborder-colorrgba249 249 (1 minute 30 seconds ago.)futuh (1 minute 55 seconds ago.)why hendricks gets so much movement, darvish’s contract, funniest sports moment, and other cubs bullets (2 minutes 1 second ago.)青岛朗阁教育 (2 minutes 1 second ago.)bernalte y leon arquitectos (2 minutes 6 seconds ago.)book bus tickets online (2 minutes 9 seconds ago.)linkattrtitle (2 minutes 41 seconds ago.)interes (2 minutes 42 seconds ago.)semchat (2 minutes 42 seconds ago.)