Alexandrafink.net Favicon Alexandrafink.net

Alexandrafink.net Website Thumbnail
Checking...
Alexandra Fink
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
alexandrafink
Domain extension
net
Domain registered:
2016-03-13
Domain updated:
2020-03-14
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is alexandrafink.net ranked relative to other sites:

Percentage of visits to alexandrafink.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Alexandrafink.net registered?
A: Alexandrafink.net was registered 4 years, 6 months, 2 weeks, 3 days, 23 hours, 7 minutes, 55 seconds ago on Sunday, March 13, 2016.
Q: When was the WHOIS for Alexandrafink.net last updated?
A: The WHOIS entry was last updated 6 months, 2 weeks, 2 days, 23 hours, 7 minutes, 55 seconds ago on Saturday, March 14, 2020.
Q: What are Alexandrafink.net's nameservers?
A: DNS for Alexandrafink.net is provided by the following nameservers:
  • ns-cloud-b1.googledomains.com
  • ns-cloud-b2.googledomains.com
  • ns-cloud-b3.googledomains.com
  • ns-cloud-b4.googledomains.com
Q: Who is the registrar for the Alexandrafink.net domain?
A: The domain has been registered at Google LLC.
Q: What is the traffic rank for Alexandrafink.net?
A: Alexandrafink.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Alexandrafink.net each day?
A: Alexandrafink.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Alexandrafink.net resolve to?
A: Alexandrafink.net resolves to the IPv4 address 198.185.159.144.
Q: In what country are Alexandrafink.net servers located in?
A: Alexandrafink.net has servers located in the United States.
Q: What webserver software does Alexandrafink.net use?
A: Alexandrafink.net is powered by Squarespace webserver.
Q: Who hosts Alexandrafink.net?
A: Alexandrafink.net is hosted by Squarespace, Inc. in New York, New York, United States, 10013.
Q: How much is Alexandrafink.net worth?
A: Alexandrafink.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Alexandrafink.net?

Alexandrafink.net Hosting Provider Information

Hosted IP Address:198.185.159.144
Hosted Hostname:198.185.159.144
Service Provider:Squarespace, Inc.
Hosted Country:United StatesUS
Location Latitude:40.7157
Location Longitude:-74
Webserver Software:Squarespace

Is "Squarespace, Inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Alexandrafink.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
date: Sun, 06 Sep 2020 11:00:15 GMT
expires: Thu, 01 Jan 1970 00:00:00 GMT
x-content-type-options: nosniff
content-type: text/html;charset=utf-8
etag: W/"d8b6918a665f9b5ffe9b1e11b916e67a--gzip"
content-encoding: gzip
Vary: Accept-Encoding
Age: 184974
Accept-Ranges: bytes
Content-Length: 27273
x-contextid: kt06R2cu/aWGS9qnB
server: Squarespace

Alexandrafink.net Domain Nameserver Information

HostIP AddressCountry
ns-cloud-b1.googledomains.com 216.239.32.107
ns-cloud-b2.googledomains.com 216.239.34.107
ns-cloud-b3.googledomains.com 216.239.36.107
ns-cloud-b4.googledomains.com 216.239.38.107


Need to find out who hosts Alexandrafink.net?


WhoIs information for Alexandrafink.net

 Domain Name: alexandrafink.net
Registry Domain ID: 2012042720_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.google.com
Registrar URL: https://domains.google.com
Updated Date: 2020-03-14T05:40:26Z
Creation Date: 2016-03-13T20:00:59Z
Registrar Registration Expiration Date: 2021-03-13T20:00:59Z
Registrar: Google LLC
Registrar IANA ID: 895
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8772376466
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: Contact Privacy Inc. Customer 124288905
Registrant Organization: Contact Privacy Inc. Customer 124288905
Registrant Street: 96 Mowat Ave
Registrant City: Toronto
Registrant State/Province: ON
Registrant Postal Code: M4K 3K1
Registrant Country: CA
Registrant Phone: +1.4165385487
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID:
Admin Name: Contact Privacy Inc. Customer 124288905
Admin Organization: Contact Privacy Inc. Customer 124288905
Admin Street: 96 Mowat Ave
Admin City: Toronto
Admin State/Province: ON
Admin Postal Code: M4K 3K1
Admin Country: CA
Admin Phone: +1.4165385487
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID:
Tech Name: Contact Privacy Inc. Customer 124288905
Tech Organization: Contact Privacy Inc. Customer 124288905
Tech Street: 96 Mowat Ave
Tech City: Toronto
Tech State/Province: ON
Tech Postal Code: M4K 3K1
Tech Country: CA
Tech Phone: +1.4165385487
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: NS-CLOUD-B1.GOOGLEDOMAINS.COM
Name Server: NS-CLOUD-B2.GOOGLEDOMAINS.COM
Name Server: NS-CLOUD-B3.GOOGLEDOMAINS.COM
Name Server: NS-CLOUD-B4.GOOGLEDOMAINS.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-05-08T04:04:50Z

Alexandrafink.net Free SEO Report

Website Inpage Analysis for Alexandrafink.net

H1 Headings

2 :
  1. Alexandra Fink
  2. Writer, Artist, Brand Strategist

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

2 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

3:
  1. Art
    http://alexandrafink.net/art
  2. Portfolio
    http://alexandrafink.net/portfolio
  3. Resume
    http://alexandrafink.net/resume

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Alexandrafink.net

useiconfill4183c4sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover vimeosqsalbumminimal dataslicetypealbum sqsslicealbumplaylistdemoalbumdataslicetypebuttonsrdiodataslicetypesocialiconshover googleplayhoversqsslidewrapperdataslidetypecoverpagelinkediniconwrapperwidth36pxheight36pxmargin0sqsslicegroupgroupcontentsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledmeetup5pxuseiconfillec4652sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstyleknockoutul li asqsslidewrapperdataslidetypecoverpageapplepodcasteaseoutopacityiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstyleknockouttracksasqsslidewrapperdataslidetypecoverpageuseiconfill7ac143sqsslidewrapperdataslidetypecoverpageusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesoliddataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstylesolidsnapchathoverdataslicetypesocialiconshover smugmugdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstylesoliduseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleborderdataslicetypepasswordresponsivewrapperstacked sqsslicecustomformsoundcloudbandsintownhoveraudioplayericonsstylesolid01sresponsivewrapperstacked dataslicetypebuttonsdataslicetypesocialicons googledataslicetypealbum sqsslicealbumplaylistdemoalbumsocialiconscolorstandardsocialiconsstyleregulardataslicetypesocialicons facebookflickrhover2s easeinotransitionopacitytwitchresponsivewrapperstacked dataslicetypecustomformsocialiconssizeextralargesocialiconsstyleborderuseiconfill0099e5sqsslidewrapperdataslidetypecoverpageactionsstacked inputwrappergmnoprintgithubsocialiconsstylesolid dataslicetypesocialiconshover iconwrapperemailsqsslicealbumplaylistdemoalbumdataslicetypesocialiconshover smugmughoverdataslicetypesocialiconshover meetupvscogmstyleccdataslicetypecountdown countdowncontentdataformattextual countdownunitavisitedsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons youtubedataslicetypesocialicons houzzonly screendataslicetypesocialiconshover stitcherhovermapstyleminimaldarkbuttonstyleoutlinesqsmodallightbox formwrapperdataslicetypesocialiconshover codepenhoveralignmentcenter responsivewrapperstackediconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstylesolidlidataslicetypegallery galleryvideobackgrounddataslicetypesocialicons stitchersqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleautofacebookhoverdataslicetypecustomformeaseinoutsqsslidewrapperdataslidetypecoverpageaudioplayericonsstyleborder dataslicetypealbumvideoiconstyleknockoutuseiconfillcc2127sqsslidewrapperdataslidetypecoverpageimportantsqsslidewrapperdataslidetypecoverpagedataslicetypepassword inputtypepasswordsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover foursquarehoversqsslicealbumplaylistdataslicetypesocialicons yelpsocialiconssizesmallsocialiconsstyleborderlightboxinnersocialiconssizesmallsocialiconsstyleregularall and maxwidth600pxsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover rdiodataslicetypesocialicons pinterestp asqsslidewrapperdataslidetypecoverpagedataslicetypebuttons li ahoversqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstyleknockouttracktitlevinehoveruseiconfill00b488sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover googleplayreddithover5emfont14pxgoogleplayhoversqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutlinebuttonstylesolidiconwrapperlastchildsqsslidewrapperdataslidetypecoverpageuseiconfillea4c89sqsslidewrapperdataslidetypecoverpagesocialiconssizemediumsocialiconsstyleborder2s easeinmstransitionopacity 2s0 0sqsslidewrapperdataslidetypecoverpageuseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpageinputwrappernothiddenbordercolor 170msinputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypecoverpagepinteresttwitterhoverdataslicetypesocialicons dropboxdataslicetypesocialiconshover spotifydataslicetypesocialiconshover instagramhovercodepenusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconseaseinout bordercolor 170msiconwrapperwidth24pxheight24pxmargin0useiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconsinstagramhoverusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutdataslicetypesocialicons bandsintownalignmentright responsivewrapperstacked2sdataslicetypesocialiconshover twitchredditpasswordstyleunderlined dataslicetypepasswordiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstyleknockoutdataslicetypebuttons ulsqsslidewrapperdataslidetypecoverpagesocialstackedtextalignleft dataslicetypesocialicons1suseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialicons2s easeinmstransitionopacityspotifyhoveruseiconfillf94877sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons vimeo0px 0pxiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstylesolideaseinoutmoztransitionbackgroundcolor 170ms easeinoutmstransitionbackgroundcolorinstagrameaseinmstransitionopacitydataslicetypesocialiconshover youtubehover170ms easeinout bordercolorsqsslidewrapperdataslidetypecoverpage responsivewrappernotstackedsvgsocialwebkittransitionbackgroundcolor 170msstumbleuponhoverdataslicetypealbumhover iconwrapperdataslicetypebuttons asqsslidewrapperdataslidetypecoverpagebuttonstyleoutline dataslicetypebuttonsuseiconfill35465dsqsslidewrapperdataslidetypecoverpage170ms easeoutopacity 170mslockstylesolid dataslicetypelockcountdowncontentdataformattextualdataslicetypesocialicons thedotsdataslicetypealbum sqsslicealbumplaylistdataslicetypesocialicons vevolightboxcontent formwrapperbuttonsqsslidewrapperdataslidetypecoverpage2s easeintransitionopacitydataslicetypesocialicons goodreadsdataslicetypesocialiconshover rsshoversqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinline dataslicetypebuttonslockstyleknockouteaseinoutotransitionbackgroundcolor 170ms easeinouttransitionbackgroundcolordataslicetypesocialiconshover thedotshoverahoversqsslidewrapperdataslidetypecoverpageaudioplayericonsstyleknockoutsqsalbumminimalbandsintownactionsnotstacked inputwrappernothiddendataslicetypesocialiconshover stumbleuponhoversqsslicealbumplayliststackeduseiconfill222backgroundcolor222sqsslidewrapperdataslidetypecoverpageshowtracktitle sqsalbumminimal dataslicetypealbumdataslicetypealbum iconwrapperlastchildsqsslidewrapperdataslidetypecoverpageresponsivewrapperstacked dataslicetypebuttons ulsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover bandsintownscreen and maxwidth600pxsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons meetupsqssliceplaybuttoniconwrapperhovervimeohoversvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover codepensvgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaybuttonstyleoutlinesqsalbumminimal dataslicetypealbum sqsslicealbumplaylistlightboxcontent6pxsocialstackedtextalignleftuseiconfill1ab7easqsslidewrapperdataslidetypecoverpageactionssqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlined datacompoundtypepopupoverlayactiontumblrhoveruseiconfill6441a5sqsslidewrapperdataslidetypecoverpagedropboxhovervideoiconstylesolidsqsslidelayercontentapplepodcasthoverneuearialsansseriffontweightnormalfontstylenormalletterspacing6pxsqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlayenableoverlaycontentborderdataslicetypesocialicons vscosqsmodallightboxcontent lightboxinnereaseinmstransitionopacity 2s170ms easeinoutsqsslidewrapperdataslidetypecoverpageuseiconfillfffsqsslidewrapperdataslidetypecoverpageimdbhoversqsgallerycirclesqsslidewrapperdataslidetypecoverpagedatacompoundtypepopupoverlayaction errormessagesqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover dribbble0ms 0msdataslicetypesocialicons foursquaresqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleraisedasqsslidewrapperdataslidetypecoverpage dataslicetypetwitterbuttonstyleoutline datacompoundtypepopupoverlayactionuseiconfill382110sqsslidewrapperdataslidetypecoverpagesolidalignmentcenter20pxsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover snapchatpinteresthoverdataslicetypesocialiconshover facebookhoverdataslicetypesocialiconshover vimeohoveruseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoveruseiconfillf60sqsslidewrapperdataslidetypecoverpagesqsslicecustomformsqssliceplaybuttoniconwrappersqsslidewrapperdataslidetypecoverpagelockstyleregular dataslicetypelockflickrbehancedataslicetypesocialicons twitchdataslicetypebuttons ahoversqsslidewrapperdataslidetypecoverpageulul lifivehundredpix170ms easeinoutmstransitionbackgroundcolor 170msdataslicetypelockformwrapperasqsslidewrapperdataslidetypecoverpage buttonstyleoutlinedataslicetypecountdown countdowncontentdataformattextualdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstylesoliddataslicetypesocialiconshover stumbleuponpasswordstylerectangle dataslicetypepasswordsvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover squarespaceiconwrapperhover2s 2sfivehundredpixhovericonwrappersoundcloudhoversqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleauto dataslicetypebuttonssqsmodallightboxopendataslicetypealbum sqsslicealbumplaylist tracksdataslicetypebuttonssqsslidewrapperdataslidetypecoverpagesocialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconssvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolideaseinoutmoztransitioncoloruseiconfilltransparentsqsslidewrapperdataslidetypecoverpageaudioplayericonsstyleregular dataslicetypealbumrsshoverdataslicetypecountdown countdowncontentdataformatnumericsocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoversocialiconsstyleknockout dataslicetypesocialiconssqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrappernothiddeneaseinoutotransitionbackgroundcolor 170msdatacompoundtypepopupoverlayactiontumblrfffsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover imdbhovertweethandle1formwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutlineulsqsslidewrapperdataslidetypecoverpagegoodreadshoverdataslicetypesocialicons codependataslicetypesocialiconshover spotifyhoversquarespacehoverdribbblesvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolidsqsslidecontainerdataslidetypepopupoverlay captchacontainerwrapperdataslicetypesocialiconshover bandsintownhovertweettimestampdataslicetypesocialiconshover linkedinhoverusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpageuseiconfill5adfcbsqsslidewrapperdataslidetypecoverpageuseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesoliduseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverdataslicetypesocialiconshover instagramusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoveruseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpageemailhoverpsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypesocialiconshover rssbuttonstyleoutline sqsslicecustomformdataslicetypesocialicons googleplaydataslicetypesocialiconshover itunessqsslidecontainerdataslidetypepopupoverlay datacompoundtypepopupoverlayactionsqsslicegalleryitembackgroundcolor999 importantsqsslidewrapperdataslidetypecoverpageeaseinmoztransitionopacity 2ssqsalbumminimal dataslicetypealbumdataslicetypesocialiconshover linkedindataslicetypebuttons ul lisqsslidewrapperdataslidetypecoverpagesocialiconssizelargesocialiconsstyleknockoutuseiconfill55aceesqsslidewrapperdataslidetypecoverpage3pxtrackcountdownunitdataslicetypesocialiconshover applepodcastdataslicetypealbum sqsslicealbumplaylistplayinguseiconfill1ea9e1sqsslidewrapperdataslidetypecoverpageshowtracktitlepasswordstylerectanglesqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineuseiconfille52d27sqsslidewrapperdataslidetypecoverpageinputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutline datacompoundtypepopupoverlayactionuseiconfill007ee5sqsslidewrapperdataslidetypecoverpage0tracks tracklightboxcontent formwrapper psocialstackedtextalignleft dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpageuseiconfillff0031sqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangledataslicetypesocialiconshover pinteresthoverdatacompoundtypepopupoverlayaction inputtypetextsqsslidewrapperdataslidetypecoverpagesocialiconssizeextralargesocialiconsstyleregularresponsivewrapperstacked dataslicetypenavigation ulsocialiconssizemediumsocialiconsstyleknockouteaseinout bordercolor2s easeinmoztransitionopacitydataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstyleknockout170mssqsslidecontainerdataslidetypepopupoverlayoverlayalignmentleftdataslicetypebuttons li asqsslidewrapperdataslidetypecoverpagedatacompoundtypepopupoverlayaction inputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover behancevine0sqsslidewrapperdataslidetypecoverpageuseiconfille4405fsqsslidewrapperdataslidetypecoverpageeaseinouttransitionbackgroundcolor 170mssocialstacked4pxsqsslidewrapperdataslidetypecoverpage14pxdataslicetypealbum iconwrapperlastchildmarginright0sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons usemaskfilltransparentsqsslidewrapperdataslidetypecoverpageeaseintransitionopacityiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstyleknockoutsqsslidecontainerdataslidetypepopupoverlay2em 0px 0pxbuttonshapepillsocialiconsstyleborderusemaskfill222sqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstacked inputwrappernothiddeneaseinoutmoztransitionbackgroundcoloriconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstyleknockoutdataslicetypetwitterdataslicetypenavigation uldisplayblocksqsslidewrapperdataslidetypecoverpageadisplayblocksqsslidewrapperdataslidetypecoverpageli ahoversqsslidewrapperdataslidetypecoverpagedataslicetypegallerysqsgallerygriduseiconfill0063dcsqsslidewrapperdataslidetypecoverpage170ms easeoutopacityresponsivewrapperstacked dataslicetypenavigation uldisplayblocksqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons tumblrdataslicetypenavigationuseiconfilleb4924sqsslidewrapperdataslidetypecoverpagedataslicetypecountdownuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregulareaseinotransitionopacity 2seaseinotransitionopacitydataslicetypesocialicons squarespacedataslicetypesocialiconshover ituneshover2s easeinotransitionopacity 2ssocialiconssizesmallsocialiconsstyleknockouticonwrapperborder2pxlinkedinhoverdataslicetypegallery galleryvideobackgroundmobile170ms easeinoutmstransitionbackgroundcolor4pxdataslicetypesocialicons spotifysqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebody psocialiconsstylesolid dataslicetypesocialiconstwitchhoverdataslicetypesocialiconshover vineerrormessagesqsslidewrapperdataslidetypecoverpageiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstyleknockoutsqsslidelayercontentmaxwidth470pxsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover houzz0mssqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttonssqsslidecontainerdataslidetypepopupoverlayoverlayalignmentcenterdataslicetypetwitternotdatacompoundtype tweetbodythedotsresponsivewrapperstackedtextaligncentersquarespaceeaseinoutmstransitioncolordataslicetypesocialiconshover yelpsocialiconscolorstandardsocialiconsstyleborderbuttonstyleoutlinesqsmodallightboxsocialstacked dataslicetypesocialiconseaseoutopacity 170msdataslicetypesocialiconshover flickr2s easeinmoztransitionopacity 2sulstackeddataslicetypealbum trackprogressbarsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialicons2s easesqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons smugmugeasesqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled datacompoundtypepopupoverlayactiondataslicetypebuttons ul liscreendataslicetypesocialiconshoversqsmodallightboxcontent lightboxinner lightboxcontentsqsalbumminimal dataslicetypealbum sqsslicealbumplayliststackedusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoveraudioplayericonsstyleborderuseiconfillc41200sqsslidewrapperdataslidetypecoverpagedisplaytablesqsslidewrapperdataslidetypecoverpagebordercolor 170ms easeinoutsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons snapchaticonwrapperlastchildmarginright0sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover houzzhoversqsslidecontainerdataslidetypepopupoverlayoverlayloadanimationslideindataslicetypesocialiconshover vinehoverdataslicetypesocialicons applepodcastuseiconfill000sqsslidewrapperdataslidetypecoverpagehouzzhouzzhovereaseinouttransitionbackgroundcolorsocialiconssizeextrasmallsocialiconsstyleborderul lisqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover googlehoversqsslidewrapperdataslidetypecoverpage dataslicetypecountdownsocialiconsstyleregularsvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverdataslicetypesocialiconshover youtubesqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutline datacompoundtypepopupoverlayactionsqsslicecustomform asqsslidewrapperdataslidetypecoverpagedataslicetypebuttons ul2em 0pxusebackgroundfilltransparentsqsslidewrapperdataslidetypecoverpage8pxdisclaimercontainersqsslidewrapperdataslidetypecoverpageitunessocialiconscolorstandardsocialiconsstylesolidgoodreadsdataslicetypebuttons lisqsslidewrapperdataslidetypecoverpagesqsgallerycircledataslicetypesocialiconshover yelphoversvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregularituneshoverdataslicetypesocialiconshover tumblrdataslicetypebodydataslicetypealbumdataslicetypenavigation ul ligalleryvideobackgrounduseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutshowtracktitle sqsalbumminimaldataslicetypesocialicons githubdataslicetypesocialicons tidalsocialiconssizemediumsocialiconsstyleregular16pxspotifydataslicetypepassword arrowicontweetdisplaynameinputwrapperdataslicetypesocialiconshover stitcheractionsstackedformwrapper puseiconfill00b4b3sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstylesolidvscohoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstylesolidformwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpageeaseintransitionopacity 2sinputtypetextsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline2s easeintransitionopacity 2susebackgroundfillfffsqsslidewrapperdataslidetypecoverpagesqsslidewrapperdataslidetypecoverpage dataslicetypecountdown countdowncontentdataformatnumericsqsslicedatacontentemptytruedisplaynonesqsslidewrapperdataslidetypecoverpagesocialiconssizeextrasmallsocialiconsstyleregularsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttons li10pxdataslicetypesocialiconshover fivehundredpixyelpdataslicetypetwitter tweetavatargithubhoverrssinputtypesubmitsqsslidewrapperdataslidetypecoverpagemediumdataslicetypealbumhoverfoursquarebuttontypesubmitsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover iconwrapperdataslicetypemap gmnoprintsqsslicealbumplaylistplayingdataslicetypesocialiconshover vscosqsslicealbumplaylist trackseaseinoutmstransitionbackgroundcolor 170msdataslicetypebuttons lili asqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineauto dataslicetypebuttonssqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked170ms easeinoutotransitionbackgroundcoloruseiconfill0976b4sqsslidewrapperdataslidetypecoverpagefielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25emdataslicetypealbum iconwrappersqsslidewrapperdataslidetypecoverpageimportantsqsslidewrapperdataslidetypecoverpage sqsslidecontainernotautoimagebackgroundcolordataslicetypesocialicons mediumsocialiconsstyleknockoutbehancehoversocialiconssizeextralargesocialiconsstylesolideaseinoutmoztransitionbackgroundcolor 170msiconwrapperwidth28pxheight28pxmargin0dataslicetypesocialicons redditdataslicetypealbumhover iconwrapperhoveractionsnotstackedalignmentleft responsivewrapperstackeduseiconfill00ab6csqsslidewrapperdataslidetypecoverpageinputtypepasswordmozplaceholdercolorfffsqsslidewrapperdataslidetypecoverpagebuttonstyleoutlinesqsmodallightbox formwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpageeaseinouttransitionbackgroundcolor 170ms easeinoutsqsslidewrapperdataslidetypecoverpageresponsivewrapperstacked dataslicetypenavigationinputtypetextsqsslidewrapperdataslidetypecoverpageuseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshovergallerysizeextralargeeaseinoutmstransitionbackgroundcolorimportantsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypelock usebackgroundfilltransparentsqsslidewrapperdataslidetypecoverpagebuttonsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinesocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoverdataslicetypesocialiconshover fivehundredpixhovericonwrappersqsslidewrapperdataslidetypecoverpagetweetavatarsqsslicealbumplaylist tracks tracksocialiconssizemediumsocialiconsstylesoliddataslicetypesocialiconshover thedotsdataslicetypesocialiconshover emailcodepenhoveruseiconfill8c8070sqsslidewrapperdataslidetypecoverpagelockstyleknockout dataslicetypelocklockstylesoliddataslicetypesocialicons dribbbledribbblehoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstyleknockoutlightboxinner lightboxcontent formwrapperuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoverusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutdataslicetypesocialiconshover twitterhoversqsmodallightboxcontentdataslicetypesocialiconshover snapchathovericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstylesolideaseinoutotransitionbackgroundcolor170ms easeinoutmoztransitionbackgroundcolor 170msuldisplayblocksqsslidewrapperdataslidetypecoverpagealignmentrightdataslicetypesocialiconshover squarespacehoverdataslicetypealbum sqsslicealbumplayliststackedsocialiconssizelargesocialiconsstyleregularvevoasqsslidewrapperdataslidetypecoverpage buttonstyleoutline sqsslicecustomformdataslicetypesocialiconshover vevosqsslicecustomform ahoversqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrapperuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolidiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstylesoliduseiconfillae995asqsslidewrapperdataslidetypecoverpageformitemsqsslidewrapperdataslidetypecoverpagesocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconsuseiconfill1769ffsqsslidewrapperdataslidetypecoverpagedataslicetypetwitternotdatacompoundtype tweettimestamponlybordercolorsqsslidecontainernotautoimagebackgroundcolortidalvideoiconstyleregulareaseinoutmstransitionbackgroundcolor 170ms easeinoutotransitionbackgroundcolorinputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutlinedataslicetypesocialiconshover reddithoverdataslicetypebody pdataslicetypesocialicons imdbsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstackeddataslicetypesocialicons vinedataslicetypesocialiconshover soundclouddataslicetypesocialiconshover goodreadshover7px1pxdataslicetypesocialicons linkedindataslicetypealbum iconwrapperdataslicetypemapvimeo0pxdataslicetypenavigation ulsqsslicecustomformsqsslidewrapperdataslidetypecoverpagerdiohovergoogleplayalignmentleftuseiconfill84bd00sqsslidewrapperdataslidetypecoverpageallresponsivewrapperstacked dataslicetypebuttons ulvideoiconstyleborder170ms easeinoutotransitionbackgroundcolor 170msdataslicetypesocialiconslockstyleborder dataslicetypelock170ms easeinouttransitionbackgroundcolor 170msaudioplayericonsstyleregular170ms easeinouttransitionbackgroundcolordataslicetypesocialiconshover flickrhoverformitemsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlineuseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregularresponsivewrappernotstackedbuttonshaperoundedcornerssocialiconssizeextrasmallsocialiconsstylesoliddataslicetypegallerydataslicetypesocialiconshover soundcloudhoverdataslicetypesocialiconshover emailhoverdataslicetypesocialiconshover behancehoverresponsivewrapperdataslicetypesocialiconshover mediumhoverpasswordstyleunderlinedtwitterdataslicetypesocialiconshover rdiohoversocialiconsstylesolidyelphoverthedotshoverlightboxinner lightboxcontentresponsivewrapperstackeddataslicetypesocialiconshover githubdataslicetypesocialiconshover googleinputtypesubmithoversqsslidewrapperdataslidetypecoverpagesqsslidesqsslideanimationreadyformwrapper inputtypesubmithoversqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestackedsocialiconsstyleborder dataslicetypesocialiconslisqsslidewrapperdataslidetypecoverpagep ahoversqsslidewrapperdataslidetypecoverpagesocialiconsstylesolid dataslicetypesocialiconshover iconwrapperhoverdataslicetypesocialicons stumbleupontrackprogressbarlockstyleregulardataslicetypesocialiconshover meetuphovertidalhoversqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebodyeaseinoutsqsslidewrapperdataslidetypecoverpage socialiconsstylesolidsocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsdataslicetypesocialiconshover iconwrapperhoverdataslicetypesocialiconshover twitterdataslicetypesocialiconshover vscohoveruseiconfill3b5998sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover dribbblehoversqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlinedactionsstacked inputwrappernothiddenstumbleupondataslicetypesocialiconshover foursquaredataslicetypesocialicons rssdataslicetypesocialiconshover facebookbuttonsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackedbuttonstyleraiseddatacompoundtypepopupoverlayaction buttontypesubmitsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons emailuseiconfillff4500sqsslidewrapperdataslidetypecoverpagefacebookdataslicetypesocialiconshover tumblrhoversqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutlinesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestacked inputwrapperuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconsdataslicetypesocialiconshover pinterestuseiconfille6b91esqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline datacompoundtypepopupoverlayactionsmugmughoverdataslicetypesocialiconshover tidalhoveruseiconfill222sqsslidewrapperdataslidetypecoverpagesocialiconsstylesolid dataslicetypesocialiconshoverdataslicetypemap gmstyleccsqsslidewrapperdataslidetypecoverpage dataslicetypebuttonssqsmodallightboxmediumhoversqsslicecustomform spansqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstyleknockoutdataslicetypebuttons ulstackedfoursquarehoverdataslicetypesocialiconshover githubhoverdataslicetypesocialicons rdiomaxwidth600pxsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons flickrdataslicetypesocialiconshover imdbsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineautouseiconfill7dbb00sqsslidewrapperdataslidetypecoverpagesocialstacked dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpagesocialiconssizesmallsocialiconsstylesolidbuttonplaypausesmugmugimdbautoflex1dataslicetypesocialicons fivehundredpixautosqsslidewrapperdataslidetypecoverpagesocialiconssizeextrasmallsocialiconsstyleknockoutgalleryvideobackgroundmobilestitcheryoutubecountdowncontentdataformatnumericdataslicetypesocialiconshover goodreadsiconwrapperdivwebkittransformscale2moztransformscale2mstransformscale2transformscale2sqsslidewrapperdataslidetypecoverpagesocialiconssizelargesocialiconsstylesolid100mssqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangle datacompoundtypepopupoverlayactiondataslicetypesocialicons soundcloudgooglehovericonwrapperwidth32pxheight32pxmargin0dataslicetypesocialicons svgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypecoverpageinputtypepasswordsqsslidewrapperdataslidetypecoverpagedataslicetypepassword inputtypepasswordmozplaceholdercolorfffsqsslidewrapperdataslidetypecoverpage2emdataslicetypesocialicons instagramdataslicetypealbum tracktitledataslicetypetwitternotdatacompoundtypeusemaskfilltransparentsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover tidaluseiconfill006ed2sqsslidewrapperdataslidetypecoverpageaudioplayericonsstylesolid dataslicetypealbumhoversvgsocialwebkittransitionbackgroundcolordataslicetypesocialicons behancedropbox170ms easeinoutmoztransitionbackgroundcolorsocialiconssizeextralargesocialiconsstyleknockouttweetbodydataslicetypesocialiconshover twitchhoverfielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25em 5emfont14pxeaseinouticonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstylesolidsocialiconssizelargesocialiconsstyleborderdataslicetypesocialiconshover mediumlockstyleborder170ms easeinoutsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoversqssliceplaybuttoniconwrappereaseinouttransitioncolorbuttonstyleoutlinevevohoversocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconssnapchatarrowiconeaseinmoztransitionopacitydataslicetypesocialiconshover redditsocialiconscolorstandardsocialiconsstyleknockoutdataslicetypesocialiconshover dropboxuseiconfille0393esqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover applepodcasthoversqsslicegalleryitembackgroundcolor999dataslicetypesocialiconshover dropboxhovermeetuphovergoogledataslicetypesocialicons twittersocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverspansqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons itunescountdowncontentdataformattextual countdownunitstitcherhoverdataslicetypesocialiconshover vevohoversvgsocialwebkittransitionbackgroundcolor 170ms easeinoutmoztransitionbackgroundcoloruseiconfilldc4e41sqsslidewrapperdataslidetypecoverpagecaptchacontainerwrappersocialiconsstyleregular dataslicetypesocialiconseaseinoutotransitioncoloryoutubehover

Longtail Keyword Density for Alexandrafink.net

KeywordsOccurences
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons44
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
sqs-modal-lightbox-content lightbox-inner lightbox-content19
170ms ease-in-out border-color15
ease-in-out border-color 170ms15
lightbox-inner lightbox-content form-wrapper14
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlist14
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons12
data-slice-typealbum sqs-slice-album-playlist tracks11
socialstacked data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
socialstackedtext-align-left data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
170ms ease-in-outtransitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color 170ms8
170ms ease-in-out-moz-transitionbackground-color 170ms8
responsive-wrapperstacked data-slice-typenavigation ul7
sqs-slice-album-playlist tracks track7
data-slice-typebuttons ul lisqs-slide-wrapperdata-slide-typecover-page7
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons6
responsive-wrapperstacked data-slice-typebuttons ul6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons6
2em 0px 0px6
show-track-title sqs-album-minimal data-slice-typealbum6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
ease-in-out-moz-transitionbackground-color 170ms ease-in-out-ms-transitionbackground-color6
ease-in-outtransitionbackground-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page6
ease-in-out-o-transitionbackground-color 170ms ease-in-outtransitionbackground-color6
ease-in-out-ms-transitionbackground-color 170ms ease-in-out-o-transitionbackground-color6
data-slice-typebuttons li asqs-slide-wrapperdata-slide-typecover-page5
data-slice-typenavigation ul li5
170ms ease-outopacity 170ms5
data-slice-typebuttons ul li4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons li4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody p4
svgsocial-webkit-transitionbackground-color 170ms ease-in-out-moz-transitionbackground-color4
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapperhover4
lightbox-content form-wrapper p4
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked input-wrappernothidden4
all and max-width600pxsqs-slide-wrapperdata-slide-typecover-page4
responsive-wrapperstacked data-slice-typebuttons ulsqs-slide-wrapperdata-slide-typecover-page4
sqs-slide-wrapperdata-slide-typecover-page data-slice-typecountdown countdown-contentdata-formatnumeric3
data-slice-typecountdown countdown-contentdata-formattextual countdown-unit3
button-style-outlinesqs-modal-lightbox form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrapper3
buttonsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked3
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline3
data-slice-typebuttons li ahoversqs-slide-wrapperdata-slide-typecover-page3
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapper3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrappernothidden3
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline data-compound-typepopup-overlay-action3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-solid3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playliststacked3
ul li asqs-slide-wrapperdata-slide-typecover-page3
2s ease-in-moz-transitionopacity 2s3
2s ease-in-ms-transitionopacity 2s3
2s ease-in-o-transitionopacity 2s3
2s ease-intransitionopacity 2s3
border-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlistdemo-album3
screen and max-width600pxsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-knockout3
asqs-slide-wrapperdata-slide-typecover-page button-style-outline sqs-slice-custom-form3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-solid3
responsive-wrapperstacked data-slice-typenavigation uldisplayblocksqs-slide-wrapperdata-slide-typecover-page3
social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons176
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover176
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover88
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons88
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid88
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover88
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons44
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid44
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout44
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page34
sqs-album-minimal data-slice-typealbum25
sqs-modal-lightbox-content lightbox-inner21
socialstackedtext-align-left data-slice-typesocial-icons20
socialstacked data-slice-typesocial-icons20
lightbox-inner lightbox-content19
data-slice-typecountdown countdown-contentdata-formatnumeric18
data-slice-typealbum sqs-slice-album-playlist15
170ms ease-in-out15
border-color 170ms15
ease-in-out border-color15
data-slice-typebuttons ul15
data-slice-typegallery gallery-video-background14
lightbox-content form-wrapper14
170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page13
data-slice-typenavigation ul13
sqs-slide-containerdata-slide-typepopup-overlay data-compound-typepopup-overlay-action12
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-border12
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked12
data-slice-typealbum icon-wrapper11
responsive-wrapperstacked data-slice-typenavigation11
responsive-wrapperstacked data-slice-typebuttons11
data-slice-typecountdown countdown-contentdata-formattextual11
0 0sqs-slide-wrapperdata-slide-typecover-page11
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked11
sqs-slice-album-playlist tracks11
data-slice-typealbum icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
data-slice-typealbum icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typecover-page10
data-slice-typealbum icon-wrapperlast-childsqs-slide-wrapperdata-slide-typecover-page10
password-style-underlined data-slice-typepassword10
data-slice-typebuttons li10
ul li9
data-slice-typebuttons ulsqs-slide-wrapperdata-slide-typecover-page9
password-style-rectangle data-slice-typepassword9
170ms ease-in-out-moz-transitionbackground-color8
ease-in-out-ms-transitionbackground-color 170ms8
ease-in-outtransitionbackground-color 170ms8
social-icons-style-solid data-slice-typesocial-iconshover8
170ms ease-in-out-o-transitionbackground-color8
data-slice-typebody p8
170ms ease-in-out-ms-transitionbackground-color8
data-slice-typebuttons asqs-slide-wrapperdata-slide-typecover-page8
ease-in-out-moz-transitionbackground-color 170ms8
ul lisqs-slide-wrapperdata-slide-typecover-page8
ease-in-out-o-transitionbackground-color 170ms8
li asqs-slide-wrapperdata-slide-typecover-page8
170ms ease-in-outtransitionbackground-color8
sqs-slice-custom-form asqs-slide-wrapperdata-slide-typecover-page7
show-track-title sqs-album-minimal7
button-style-outline data-compound-typepopup-overlay-action7
social-icons-style-border data-slice-typesocial-icons7
button-style-outlinesqs-modal-lightbox form-wrapper7
tracks track7
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
0px 0px6
data-slice-typesocial-iconshover icon-wrapperhover6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
2em 0px6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout6
data-slice-typealbum track-progress-bar6
button-style-outline sqs-slice-custom-form6
button-style-outline data-slice-typebuttons6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle data-compound-typepopup-overlay-action6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-compound-typepopup-overlay-action6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline data-compound-typepopup-overlay-action6
audio-player-icons-style-border data-slice-typealbum6
data-slice-typesocial-icons email5
data-slice-typesocial-icons medium5
data-slice-typesocial-icons squarespace5
data-slice-typesocial-icons meetup5
data-slice-typesocial-icons spotify5
data-slice-typesocial-icons vimeo5
data-slice-typesocial-icons googleplay5
data-slice-typesocial-icons dropbox5
data-slice-typesocial-icons vine5
data-slice-typesocial-icons pinterest5
data-slice-typesocial-icons rdio5
data-slice-typesocial-icons soundcloud5
data-slice-typesocial-icons reddit5
data-slice-typesocial-icons snapchat5
data-slice-typesocial-icons rss5
data-slice-typesocial-icons dribbble5
data-slice-typesocial-icons facebook5
data-slice-typesocial-icons tidal5
data-slice-typesocial-icons stumbleupon5
data-slice-typesocial-icons google5
data-slice-typesocial-icons houzz5
data-slice-typesocial-icons tumblr5
data-slice-typesocial-icons goodreads5
data-slice-typesocial-icons thedots5
data-slice-typesocial-icons github5
data-slice-typesocial-icons instagram5
data-slice-typesocial-icons twitch5
data-slice-typesocial-icons vevo5
data-slice-typesocial-icons itunes5
data-slice-typesocial-icons foursquare5
data-slice-typesocial-icons stitcher5
data-slice-typesocial-icons twitter5
data-slice-typesocial-icons linkedin5
data-slice-typesocial-icons flickr5
data-slice-typesocial-icons fivehundredpix5
data-slice-typesocial-icons imdb5
alignment-right responsive-wrapperstacked5
ease-outopacity 170ms5
170ms ease-outopacity5
2s 2s5
0ms 0ms5
data-slice-typesocial-iconshover icon-wrapper5
lock-style-regular data-slice-typelock5
data-slice-typesocial-icons applepodcast5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined data-compound-typepopup-overlay-action5
data-slice-typealbum sqs-slice-album-playlistplaying5
data-slice-typesocial-icons smugmug5
data-slice-typesocial-icons youtube5
asqs-slide-wrapperdata-slide-typecover-page button-style-outline5
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody5
data-slice-typesocial-icons vsco5
data-slice-typesocial-icons bandsintown5
data-slice-typesocial-icons yelp5
data-slice-typesocial-icons behance5
alignment-left responsive-wrapperstacked5
alignment-center responsive-wrapperstacked5
sqs-slide-wrapperdata-slide-typecover-page data-slice-typebuttons5
data-slice-typesocial-icons codepen5
data-slice-typesocial-iconshover stitcher4
data-slice-typepassword inputtypepassword-moz-placeholdercolorfffsqs-slide-wrapperdata-slide-typecover-page4
data-slice-typesocial-iconshover stitcherhover4
actionsnotstacked input-wrappernothidden4
data-slice-typesocial-iconshover squarespacehover4
data-slice-typesocial-iconshover vinehover4
data-compound-typepopup-overlay-action inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typecover-page4
data-slice-typesocial-iconshover squarespace4
buttonsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline4
data-slice-typesocial-iconshover spotifyhover4
data-compound-typepopup-overlay-action inputtypetextsqs-slide-wrapperdata-slide-typecover-page4
data-slice-typesocial-iconshover spotify4
data-slice-typesocial-iconshover soundcloudhover4
data-slice-typesocial-iconshover soundcloud4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons4
data-slice-typesocial-iconshover snapchathover4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-compound-typepopup-overlay-action4
data-slice-typesocial-iconshover snapchat4
data-slice-typesocial-iconshover smugmughover4
lock-style-border data-slice-typelock4
data-slice-typesocial-iconshover thedotshover4
data-slice-typesocial-iconshover stumbleupon4
data-slice-typesocial-iconshover youtube4
data-slice-typesocial-iconshover vsco4
data-slice-typesocial-iconshover vscohover4
data-slice-typesocial-iconshover vine4
data-slice-typesocial-iconshover vimeohover4
data-slice-typesocial-iconshover vimeo4
data-slice-typesocial-iconshover yelp4
data-slice-typesocial-iconshover vevohover4
data-slice-typesocial-iconshover yelphover4
data-slice-typesocial-iconshover vevo4
data-slice-typesocial-iconshover twitterhover4
data-slice-typesocial-iconshover twitter4
data-slice-typesocial-iconshover twitchhover4
data-slice-typesocial-iconshover stumbleuponhover4
data-slice-typesocial-iconshover youtubehover4
data-slice-typesocial-iconshover twitch4
form-wrapper p4
data-slice-typesocial-iconshover tumblrhover4
data-slice-typesocial-iconshover tumblr4
data-slice-typesocial-iconshover tidalhover4
data-slice-typesocial-iconshover tidal4
audio-player-icons-style-solid data-slice-typealbumhover4
data-slice-typesocial-iconshover thedots4
data-slice-typealbumhover icon-wrapper4
data-slice-typealbumhover icon-wrapperhover4
data-slice-typetwitternotdata-compound-type tweet-body4
data-slice-typesocial-iconshover smugmug4
data-slice-typesocial-iconshover houzz4
data-slice-typesocial-iconshover rsshover4
data-slice-typesocial-iconshover dribbble4
data-slice-typesocial-iconshover flickrhover4
data-slice-typesocial-iconshover flickr4
data-slice-typesocial-iconshover fivehundredpixhover4
data-slice-typesocial-iconshover fivehundredpix4
data-slice-typesocial-iconshover facebookhover4
data-slice-typesocial-iconshover facebook4
data-slice-typesocial-iconshover emailhover4
data-slice-typesocial-iconshover email4
data-slice-typesocial-iconshover dropboxhover4
data-slice-typesocial-iconshover dropbox4
data-slice-typesocial-iconshover dribbblehover4
data-slice-typebuttons lisqs-slide-wrapperdata-slide-typecover-page4
data-slice-typesocial-iconshover foursquarehover4
data-slice-typesocial-iconshover codepen4
data-slice-typesocial-iconshover behancehover4
data-slice-typesocial-iconshover behance4
data-slice-typesocial-iconshover bandsintownhover4
data-slice-typesocial-iconshover bandsintown4
data-slice-typesocial-iconshover applepodcasthover4
data-slice-typesocial-iconshover applepodcast4
social-icons-style-regular data-slice-typesocial-icons4
responsive-wrapperstacked sqs-slice-custom-form4
data-slice-typesocial-iconshover rss4
svgsocial-webkit-transitionbackground-color 170ms4
data-slice-typesocial-iconshover foursquare4
data-slice-typesocial-iconshover codepenhover4
data-slice-typesocial-iconshover github4
data-slice-typesocial-iconshover linkedin4
data-slice-typesocial-iconshover reddit4
data-slice-typesocial-iconshover githubhover4
data-slice-typesocial-iconshover rdiohover4
data-slice-typesocial-iconshover rdio4
data-slice-typesocial-iconshover pinteresthover4
data-slice-typesocial-iconshover pinterest4
data-slice-typesocial-iconshover reddithover4
data-slice-typesocial-iconshover meetup4
data-slice-typesocial-iconshover mediumhover4
data-slice-typesocial-iconshover medium4
data-slice-typesocial-iconshover linkedinhover4
data-slice-typesocial-iconshover meetuphover4
data-slice-typesocial-iconshover ituneshover4
data-slice-typesocial-iconshover google4
data-slice-typesocial-iconshover goodreadshover4
data-slice-typesocial-iconshover itunes4
data-slice-typesocial-iconshover googleplay4
data-slice-typesocial-iconshover goodreads4
data-slice-typesocial-iconshover googleplayhover4
data-slice-typesocial-iconshover googlehover4
data-slice-typesocial-iconshover houzzhover4
data-slice-typesocial-iconshover imdb4
data-slice-typesocial-iconshover imdbhover4
data-slice-typesocial-iconshover instagram4
data-slice-typesocial-iconshover instagramhover4
form-itemsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked input-wrapper3
audio-player-icons-style-regular data-slice-typealbum3
importantsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em 5emfont14px3
data-slice-typemap gm-style-cc3
data-slice-typealbum track-title3
data-slice-typealbum sqs-slice-album-playlistdemo-album3
sqs-slide-containerdata-slide-typepopup-overlay captcha-container-wrapper3
data-slice-typealbum sqs-slice-album-playliststacked3
only screen3
lock-style-solid data-slice-typelock3
data-slice-typemap gmnoprint3
actionsstacked input-wrapper3
li ahoversqs-slide-wrapperdata-slide-typecover-page3
inputtypetextsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
ease-in-moz-transitionopacity 2s3
responsive-wrapperstacked data-slice-typecustom-form3
data-slice-typenavigation uldisplayblocksqs-slide-wrapperdata-slide-typecover-page3
importantsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containernotauto-image-background-color3
actionsstacked input-wrappernothidden3
sqs-slice-gallery-itembackground-color999 importantsqs-slide-wrapperdata-slide-typecover-page3
2s ease-in-moz-transitionopacity3
2s ease-in-ms-transitionopacity3
data-slice-typegallery gallery-video-backgroundmobile3
ease-in-ms-transitionopacity 2s3
2s ease-in-o-transitionopacity3
ease-in-o-transitionopacity 2s3
2s ease-intransitionopacity3
ease-intransitionopacity 2s3
data-compound-typepopup-overlay-action error-messagesqs-slide-wrapperdata-slide-typecover-page3
lock-style-knockout data-slice-typelock3
sqs-slide-wrapperdata-slide-typecover-page data-slice-typecountdown3
data-slice-typelock use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typecover-page3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-solid3
countdown-contentdata-formattextual countdown-unit3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-solid3
p ahoversqs-slide-wrapperdata-slide-typecover-page3
p asqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto data-slice-typebuttons3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-knockout3
ease-in-outsqs-slide-wrapperdata-slide-typecover-page social-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-solid3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline data-slice-typebuttons3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto data-slice-typebuttons3
data-slice-typebuttons ulstacked3
social-icons-style-knockout data-slice-typesocial-icons3
data-slice-typetwitternotdata-compound-type tweet-timestamp3
sqs-slice-custom-form spansqs-slide-wrapperdata-slide-typecover-page3
data-compound-typepopup-overlay-action buttontypesubmitsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typetwitter tweet-avatar3
asqs-slide-wrapperdata-slide-typecover-page data-slice-typetwitter3
social-icons-style-solid data-slice-typesocial-icons3
data-slice-typesocial-icons use-maskfilltransparentsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typepassword arrow-icon3
data-slice-typesocial-icons svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typepassword inputtypepasswordsqs-slide-wrapperdata-slide-typecover-page3
2s easesqs-slide-wrapperdata-slide-typecover-page3
form-wrapper inputtypesubmithoversqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-custom-form ahoversqs-slide-wrapperdata-slide-typecover-page3
data-slice-typebuttons ahoversqs-slide-wrapperdata-slide-typecover-page3
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline3
sqs-slide-wrapperdata-slide-typecover-page responsive-wrappernotstacked3
data-slice-typesocial-icons440
data-slice-typesocial-iconshover364
social-icons-color-standardsocial-icons-style-solid264
social-icons-color-standardsocial-icons-style-border176
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page140
social-icons-color-standardsocial-icons-style-knockout132
social-icons-color-standardsocial-icons-style-regular132
data-slice-typealbum109
170ms90
data-slice-typebuttons65
data-compound-typepopup-overlay-action60
sqs-slide-containerdata-slide-typepopup-overlay51
icon-wrappersqs-slide-wrapperdata-slide-typecover-page46
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page44
2s41
asqs-slide-wrapperdata-slide-typecover-page38
importantsqs-slide-wrapperdata-slide-typecover-page37
responsive-wrapperstacked36
data-slice-typecountdown35
data-slice-typegallery34
data-slice-typelock30
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline29
data-slice-typepassword29
form-wrapper28
ul28
sqs-album-minimal27
1s25
sqs-slice-custom-form25
sqs-modal-lightbox-content24
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page24
0sqs-slide-wrapperdata-slide-typecover-page24
icon-wrapper23
data-slice-typenavigation23
lightbox-inner22
021
sqs-slide-wrapperdata-slide-typecover-page21
socialstackedtext-align-left20
li20
socialstacked20
lightbox-content19
button-style-outline19
countdown-contentdata-formatnumeric18
ease-in-outsqs-slide-wrapperdata-slide-typecover-page17
sqs-slice-album-playlist17
data-slice-typebody16
tracks16
ease-in-out15
border-color15
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled15
gallery-video-background14
sqs-modal-lightbox-open14
ahoversqs-slide-wrapperdata-slide-typecover-page13
lisqs-slide-wrapperdata-slide-typecover-page13
p13
icon-wrapperhover12
actionsnotstacked12
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page12
0px12
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page12
social-icons-style-solid12
password-style-rectangle11
actionsstacked11
data-slice-typetwitter11
all11
countdown-contentdata-formattextual11
password-style-underlined11
0ms10
sqs-slice-play-buttonicon-wrappersqs-slide-wrapperdata-slide-typecover-page10
solid10
squarespace10
icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typecover-page10
icon-wrapperlast-childsqs-slide-wrapperdata-slide-typecover-page10
110
data-slice-typetwitternotdata-compound-type10
foursquare9
meetup9
flickr9
thedots9
medium9
tidal9
tumblr9
stumbleupon9
twitch9
twitter9
vevo9
github9
vimeo9
reddit9
vine9
itunes9
linkedin9
fivehundredpix9
stitcher9
snapchat9
dribbble9
rss9
ulsqs-slide-wrapperdata-slide-typecover-page9
codepen9
smugmug9
behance9
rdio9
bandsintown9
vsco9
sqs-gallery-circle9
email9
soundcloud9
applepodcast9
facebook9
pinterest9
spotify9
goodreads9
dropbox9
ease-in-outtransitionbackground-color9
houzz9
instagram9
google9
imdb9
youtube9
googleplay9
max-width600pxsqs-slide-wrapperdata-slide-typecover-page9
yelp9
ease-in-out-moz-transitionbackground-color9
ease-in-out-ms-transitionbackground-color9
ease-in-out-o-transitionbackground-color9
alignment-left8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-center8
sqs-slice-play-buttonicon-wrapper8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline8
data-slice-typealbumhover8
alignment-right8
show-track-title7
data-slice-typemap7
inputtypetextsqs-slide-wrapperdata-slide-typecover-page7
spansqs-slide-wrapperdata-slide-typecover-page7
track7
use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typecover-page7
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked7
input-wrappernothidden7
use-backgroundfillfffsqs-slide-wrapperdata-slide-typecover-page7
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page7
alignment-center7
video-icon-style-border7
button-style-outlinesqs-modal-lightbox7
sqs-slide-layer-content7
social-icons-style-border7
button-style-raised6
2em6
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page6
4px6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-left6
social-icons-style-regular6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page6
sqs-slice-play-buttonicon-wrapperhover6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page6
audio-player-icons-style-border6
audio-player-icons-style-solid6
input-wrapper6
10px6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle6
track-progress-bar6
instagramhover5
rdiohover5
pinteresthover5
meetuphover5
imdbhover5
mediumhover5
linkedinhover5
ituneshover5
use-maskfilltransparentsqs-slide-wrapperdata-slide-typecover-page5
reddithover5
twitchhover5
100ms5
ease-outopacity5
lock-style-regular5
youtubehover5
yelphover5
vscohover5
buttonsqs-slide-wrapperdata-slide-typecover-page5
vinehover5
vimeohover5
vevohover5
twitterhover5
tumblrhover5
rsshover5
tidalhover5
thedotshover5
stumbleuponhover5
social-icons-style-knockout5
stitcherhover5
squarespacehover5
spotifyhover5
soundcloudhover5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined5
01s5
snapchathover5
smugmughover5
houzzhover5
foursquarehover5
googlehover5
8px5
dropboxhover5
dribbblehover5
codepenhover5
behancehover5
bandsintownhover5
applepodcasthover5
tweet-timestamp5
facebookhover5
button-shape-rounded-corners5
gmnoprint5
gm-style-cc5
sqs-slice-album-playlistplaying5
6px5
audio-player-icons-style-regular5
svgsocial-webkit-transitionbackground-color5
emailhover5
button-shape-pill5
sqs-gallery-circlesqs-slide-wrapperdata-slide-typecover-page5
fivehundredpixhover5
githubhover5
flickrhover5
googleplayhover5
goodreadshover5
autosqs-slide-wrapperdata-slide-typecover-page4
20pxsqs-slide-wrapperdata-slide-typecover-page4
audio-player-icons-style-knockout4
video-icon-style-solid4
track-title4
inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typecover-page4
lock-style-border4
use-iconfilltransparentsqs-slide-wrapperdata-slide-typecover-page4
5px4
displaytablesqs-slide-wrapperdata-slide-typecover-page4
tweet-body4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-raised4
ulstacked4
sqs-slide-layer-contentmax-width470pxsqs-slide-wrapperdata-slide-typecover-page4
map-style-minimal-dark4
inputtypepassword-moz-placeholdercolorfffsqs-slide-wrapperdata-slide-typecover-page4
video-icon-style-regular4
icon-wrapperwidth24pxheight24pxmargin04
neuearialsans-seriffont-weightnormalfont-stylenormalletter-spacing6pxsqs-slide-wrapperdata-slide-typecover-page4
form-itemsqs-slide-wrapperdata-slide-typecover-page4
video-icon-style-knockout3
icon-wrapperwidth28pxheight28pxmargin03
icon-wrapperwidth36pxheight36pxmargin03
icon-wrapperwidth32pxheight32pxmargin03
3px3
use-iconfill222background-color222sqs-slide-wrapperdata-slide-typecover-page3
fffsqs-slide-wrapperdata-slide-typecover-page3
use-iconfille6b91esqs-slide-wrapperdata-slide-typecover-page3
7px3
button-play-pause3
use-iconfill5adfcbsqs-slide-wrapperdata-slide-typecover-page3
svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-album-playlistdemo-album3
sqs-slice-album-playliststacked3
only3
inputtypesubmithoversqs-slide-wrapperdata-slide-typecover-page3
screen3
button-style-solid3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto3
lock-style-knockout3
sqs-slide-containerdata-slide-typepopup-overlaybutton-style-outline3
lock-style-solid3
sqs-slidesqs-slide-animation-ready3
responsive-wrapper3
sqs-slicedata-content-emptytruedisplaynonesqs-slide-wrapperdata-slide-typecover-page3
data-slice-typecustom-form3
uldisplayblocksqs-slide-wrapperdata-slide-typecover-page3
responsive-wrappernotstacked3
sqs-slice-groupgroup-content3
gallery-size-extra-large3
adisplayblocksqs-slide-wrapperdata-slide-typecover-page3
responsive-wrapperstackedtext-align-center3
autoflex13
sqs-slide-containerdata-slide-typepopup-overlayenable-overlay-content-border3
actionssqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlayoverlay-load-animation-slide-in3
data-slice-typebuttonssqs-slide-wrapperdata-slide-typecover-page3
icon-wrapperdiv-webkit-transformscale2-moz-transformscale2-ms-transformscale2transformscale2sqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-custom-formsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typegallerysqs-gallery-grid3
sqs-slide-containernotauto-image-background-color3
error-messagesqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-gallery-itembackground-color9993
ease-in-moz-transitionopacity3
ease-in-ms-transitionopacity3
ease-in-o-transitionopacity3
5emfont14px3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em3
ease-intransitionopacity3
gallery-video-backgroundmobile3
use-iconfilldc4e41sqs-slide-wrapperdata-slide-typecover-page3
captcha-container-wrapper3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline3
use-iconfille0393esqs-slide-wrapperdata-slide-typecover-page3
ease-in-outtransitioncolor3
use-iconfilleb4924sqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-extra-largesocial-icons-style-knockout3
social-icons-size-extra-largesocial-icons-style-border3
social-icons-size-largesocial-icons-style-solid3
use-iconfill1ea9e1sqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-largesocial-icons-style-knockout3
social-icons-size-largesocial-icons-style-border3
social-icons-size-mediumsocial-icons-style-solid3
social-icons-size-extra-largesocial-icons-style-solid3
social-icons-size-mediumsocial-icons-style-knockout3
use-iconfill8c8070sqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-mediumsocial-icons-style-border3
4pxsqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-smallsocial-icons-style-solid3
social-icons-size-smallsocial-icons-style-knockout3
use-iconfill84bd00sqs-slide-wrapperdata-slide-typecover-page3
icon-wrapperborder2px3
social-icons-size-smallsocial-icons-style-border3
use-iconfillff4500sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill3b5998sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillcc2127sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill00ab6csqs-slide-wrapperdata-slide-typecover-page3
use-iconfill006ed2sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill007ee5sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill0063dcsqs-slide-wrapperdata-slide-typecover-page3
use-iconfillea4c89sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillf60sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill0976b4sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill1769ffsqs-slide-wrapperdata-slide-typecover-page3
use-iconfill7dbb00sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillf94877sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill00b4b3sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill4183c4sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill000sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill35465dsqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-extra-smallsocial-icons-style-solid3
ease-in-out-o-transitioncolor3
1px3
avisitedsqs-slide-wrapperdata-slide-typecover-page3
use-iconfille52d27sqs-slide-wrapperdata-slide-typecover-page3
tweet-handle3
tweet-display-name3
tweet-avatar3
sqs-modal-lightbox3
use-iconfill7ac143sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillc41200sqs-slide-wrapperdata-slide-typecover-page3
disclaimer-containersqs-slide-wrapperdata-slide-typecover-page3
buttontypesubmitsqs-slide-wrapperdata-slide-typecover-page3
use-iconfill382110sqs-slide-wrapperdata-slide-typecover-page3
countdown-unit3
use-iconfille4405fsqs-slide-wrapperdata-slide-typecover-page3
ease-in-out-moz-transitioncolor3
use-iconfill0099e5sqs-slide-wrapperdata-slide-typecover-page3
inputtypepasswordsqs-slide-wrapperdata-slide-typecover-page3
easesqs-slide-wrapperdata-slide-typecover-page3
use-iconfill6441a5sqs-slide-wrapperdata-slide-typecover-page3
16px3
social-icons-size-extra-smallsocial-icons-style-knockout3
social-icons-size-extra-smallsocial-icons-style-border3
use-iconfill55aceesqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-extra-largesocial-icons-style-regular3
use-iconfillec4652sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillff0031sqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-largesocial-icons-style-regular3
arrow-icon3
use-iconfill1ab7easqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-mediumsocial-icons-style-regular3
social-icons-size-smallsocial-icons-style-regular3
use-iconfill00b488sqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-extra-smallsocial-icons-style-regular3
14px3
use-iconfillae995asqs-slide-wrapperdata-slide-typecover-page3
ease-in-out-ms-transitioncolor3

Alexandrafink.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Alexandrafink.net is a scam?

Websites with Similar Names

Alexa-aimes.com
alexa-aimes.com - Registered at Namecheap.com
Alexa-audio.de
Startseite - Alexa Audioproduktion - Audioguides
Alexa-australia.xyz
alexa-australia.xyz
Alexa-beauty.com
Главная страница
Alexa-benkert.com
alexa benkert
Alexa-capital.net
Want your own website? | 123 Reg
Alexa-davalos.org
Domain Names | The World's Largest Domain Name Registrar - GoDaddy uk
Alexa-designer.com
Vocal Apps | Dialog solutions for the Internet of Things

Recently Updated Websites

Intermatwrestle.com 2 seconds ago.Dinudoubleu.com 3 seconds ago.Matrimonioincalifornia.com 4 seconds ago.Bushido.ie 4 seconds ago.Mage-themes.com 4 seconds ago.Veda-ayurveda.com 5 seconds ago.Homesindallasga.com 6 seconds ago.Legacymediaworks.com 7 seconds ago.Tasleehshooting.com 7 seconds ago.20carbsdaily.com 8 seconds ago.Jasontoddcooper.com 8 seconds ago.Vermilionohionews.com 9 seconds ago.Conveyint.com 10 seconds ago.Ogorodnye-shpargalki.ru 10 seconds ago.Prodplast.com 11 seconds ago.Slotsofvegas.club 12 seconds ago.Bsfjc.com 12 seconds ago.Tromsojazzfestival.com 13 seconds ago.7132silver.com 14 seconds ago.Brelby.com 14 seconds ago.Drungar.com 15 seconds ago.Staples.com.tw 15 seconds ago.R5p.de 16 seconds ago.Tloose.com 16 seconds ago.Systemicstorytelling.org 17 seconds ago.Suregripfootwear.com 17 seconds ago.Toulousedubclub.com 17 seconds ago.Charlesrutenberghomes.com 18 seconds ago.Wpautobahn.com 18 seconds ago.Queer-as-folk.it 18 seconds ago.