Allcelebrities.org.ua  |  All celebrities — Фото всех иностранных знаменитостей, моделей, звёзд кино и шоу-бизнеса
Low trust score  | 
Фотографии всех иностранных знаменитостей, эротика, wallpaper, обои и сканы




Allcelebrities.org.ua Website Information

Website Ranks & Scores for Allcelebrities.org.ua

Statvoo Rank Statvoo Rank:H
Alexa Rank Alexa Rank:504,297
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:22%
DMOZ DMOZ Listing:No

Whois information for allcelebrities.org.ua

Full Whois Lookup for Allcelebrities.org.ua Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Allcelebrities.org.ua. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% request from 2a01:7e00::f03c:91ff:fe84:f734
% This is the Ukrainian Whois query server #B.
% The Whois is subject to Terms of use
% See https://hostmaster.ua/services/
%

domain: allcelebrities.org.ua
dom-public: NO
registrant: urggp15772
admin-c: urggp15772
tech-c: urggp15772
mnt-by: ua.tuthost
nserver: ns3.r53.com.ua
nserver: ns2.r53.com.ua
nserver: ns1.r53.com.ua
status: ok
created: 2010-03-31 17:39:56+03
modified: 2017-03-24 21:17:23+02
expires: 2018-03-31 17:39:56+03
source: UAEPP

% Registrar:
% ==========
registrar: ua.tuthost
organization: SE Semenyuk Denis
organization-loc: ФОП Семенюк Денис Павлович
url: http://tuthost.com/
city: Kyiv
country: UA
source: UAEPP

% Registrant:
% ===========
contact-id: urggp15772
person: n/a
person-loc: not published
organization-loc: not published
e-mail: not published
address: n/a
address-loc: not published
phone: +38.0988363673
mnt-by: ua.tuthost
status: ok
status: linked
created: 2012-12-02 19:52:59+02
source: UAEPP

% Administrative Contacts:
% =======================
contact-id: urggp15772
person: n/a
person-loc: not published
organization-loc: not published
e-mail: not published
address: n/a
address-loc: not published
phone: +38.0988363673
mnt-by: ua.tuthost
status: ok
status: linked
created: 2012-12-02 19:52:59+02
source: UAEPP

% Technical Contacts:
% ===================
contact-id: urggp15772
person: n/a
person-loc: not published
organization-loc: not published
e-mail: not published
address: n/a
address-loc: not published
phone: +38.0988363673
mnt-by: ua.tuthost
status: ok
status: linked
created: 2012-12-02 19:52:59+02
source: UAEPP


% Query time: 38 msec

Who hosts Allcelebrities.org.ua?

Allcelebrities.org.ua is hosted by ON-LINE Ltd in Ukraine.
Allcelebrities.org.ua has an IP Address of 195.248.235.240 and a hostname of f2.r53.com.ua and runs nginx/1.4.3 web server.



Allcelebrities.org.ua Web Server Information

Hosted IP Address:195.248.235.240
Hosted Hostname:f2.r53.com.ua
Service Provider:ON-LINE Ltd
Hosted Country:UkraineUA
Location Latitude:50.45
Location Longitude:30.5233
Webserver Software:nginx/1.4.3

HTTP Header Analysis for Allcelebrities.org.ua

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.4.3
Date: Tue, 15 Sep 2015 19:08:40 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/5.3.28
Content-Encoding: gzip


Need to find out who hosts Allcelebrities.org.ua?

Allcelebrities.org.ua Free SEO Report

Website Inpage Analysis for Allcelebrities.org.ua

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Allcelebrities.org.ua

emmacassieheidifoxharrisjonesjuliekatjafernandaderjennyannjodieestherwilliamsanahilarycameroncarmenisabelledelceciliacourtneydianastevensannadianekellykimberlysmithamandajillandersonevekymleegretchenbonniekatedominiquemoorecamiladavisangieginachelseagabrielaelisabethamericavergarathompsonmariajanetjanealexbrigitteelsajoanjoycarolinaaliciaelisakristenisabeleugeniaellenbiancajennaandreapageburkeallhelenjenniferchristahannahfernandezallisongloriaalbajanabethchristyalanacollinsclaudiajenniehelenadanielaelizabethkardashiancheryljacksonkingmolinakerryheatheranitawilsonwalshkatharineamyfisherjuliannealessiaelenacrystalvan deradrianneeleonorabeatricebrookscandacekatherinekimbachjokimberleyfedericaangelakathleenwebercarlsonfrancescaclaireirinataylorjaimejamiedeborahjacquelinekatyalinamillervarjuliettemarieemilydebraashleycoxalessandrabrookecynthiaangeladrianaevalewiswagnerlucasjillianchloekatkaraaliivanakatiebelenryanbarbaradebbiegrahamvancarolinegeorginachristinacarlagonzalezkarinahollykatarinaerikahallcandicedenisejoannabrendaalexisaprilgabriellebridgetdaniellecatherinelekarolinaholdencristinajodijosiecarriecharlottejessicaalinejohnsondrewrosealisonrichardsonalexandraannecindyall celebritieschristinejuliaemmanuelledonnarobertskarenparkergemmakerrikristinerincamillaantonellakeridawnkathrynflaviaadrienneaubreyalicebrittanyambergailcelebritieskatrinagirls

Longtail Keyword Density for Allcelebrities.org.ua

KeywordsOccurences
van der4
all celebrities3
anna32
jennifer30
jessica30
kelly25
amanda23
kate23
amy20
claudia18
ana17
emma17
eva17
barbara17
christina17
kim16
alexandra16
elizabeth14
ashley13
julie13
holly11
lee11
van11
andrea11
erin11
emily11
angela11
daniela10
charlotte10
catherine10
julia10
carla10
marie9
anne9
alice9
heather9
jenny9
alicia9
cheryl8
bianca8
elena8
danielle8
deborah8
carolina8
gemma8
amber8
alison7
claire7
jenna7
caroline7
brooke7
kristen7
joanna7
helena7
jane7
alessandra7
erika7
gina7
smith7
helen6
fernanda6
bridget6
kristin6
anderson6
kimberly6
adriana6
heidi6
katie6
diane6
courtney6
ali6
taylor6
page6
walsh5
gloria5
carrie5
jamie5
ann5
gonzalez5
fernandez5
chelsea5
debra5
lewis5
alex5
christine5
camila5
elsa5
gabrielle5
irina5
karina5
alexis5
katy5
johnson5
eve5
kimberley5
roberts5
hall5
karen5
belen4
ellen4
adrienne4
kathleen4
drew4
denise4
kerry4
moore4
dominique4
donna4
carmen4
april4
elisabeth4
francesca4
jacqueline4
isabelle4
jodi4
jaime4
janet4
jillian4
jennie4
isabel4
debbie4
alina4
kat4
esther4
gail4
kara4
jodie4
alessia4
katherine4
emmanuelle4
brigitte4
cassie4
christy4
cindy4
beth4
miller4
wagner4
angie4
christa4
anita4
cecilia4
der4
hannah4
brittany4
cynthia4
jones4
cameron4
wilson3
julianne3
joy3
josie3
jill3
aline3
weber3
richardson3
camilla3
fox3
graham3
brenda3
celebrities3
joan3
antonella3
aubrey3
kerri3
keri3
cristina3
kardashian3
maria3
var3
kym3
burke3
holden3
katrina3
katja3
karolina3
girls3
ryan3
bonnie3
allison3
katarina3
kathryn3
beatrice3
katharine3
juliette3
collins3
lucas3
jo3
chloe3
molina3
angel3
eugenia3
fisher3
federica3
adrianne3
all3
cox3
alba3
diana3
parker3
harris3
crystal3
king3
elisa3
eleonora3
thompson3
flavia3
jackson3
del3
hilary3
carlson3
bach3
dawn3
ivana3
candace3
candice3
alana3
rose3
gretchen3
brooks3
williams3
vergara3
gabriela3
america3
davis3
le3
georgina3
stevens3
jana3

What are the nameservers for allcelebrities.org.ua?

Allcelebrities.org.ua Domain Nameserver Information

HostIP AddressCountry
ns2.r53.com.ua 195.248.235.240Ukraine Ukraine
ns3.r53.com.ua 148.251.13.83Germany Germany
ns1.r53.com.ua 31.41.216.90Ukraine Ukraine

Allcelebrities.org.ua Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Allcelebrities.org.ua is a scam?