Alpha1news.gr

Website Thumbnail
Checking...
Alpha1News

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-22
Category: This site has not been categorized yet

YOUR DESCRIPTION HERE


Domain summary

Domain label
alpha1news
Domain extension
gr
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is alpha1news.gr ranked relative to other sites:

Percentage of visits to alpha1news.gr from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Alpha1news.gr registered?
A: Alpha1news.gr was registered 1 month, 6 days, 20 hours, 9 minutes, 15 seconds ago on Thursday, October 22, 2020.
Q: When was the WHOIS for Alpha1news.gr last updated?
A: The WHOIS entry was last updated 1 month, 6 days, 20 hours, 9 minutes, 15 seconds ago on Thursday, October 22, 2020.
Q: Who is the registrar for the Alpha1news.gr domain?
A: The domain has been registered at .
Q: What is the traffic rank for Alpha1news.gr?
A: Alpha1news.gr has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Alpha1news.gr each day?
A: Alpha1news.gr receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Alpha1news.gr resolve to?
A: Alpha1news.gr resolves to the IPv4 address 216.239.38.21.
Q: In what country are Alpha1news.gr servers located in?
A: Alpha1news.gr has servers located in the Mexico.
Q: What webserver software does Alpha1news.gr use?
A: Alpha1news.gr is powered by GSE webserver.
Q: Who hosts Alpha1news.gr?
A: Alpha1news.gr is hosted by Google Inc. in Mexico City, Mexico City, Mexico, 01090.
Q: How much is Alpha1news.gr worth?
A: Alpha1news.gr has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Alpha1news.gr Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Alpha1news.gr Free SEO Report

Website Inpage Analysis for Alpha1news.gr

H1 Headings

0 :

H2 Headings

34 :
  1. Alpha 1 News
  2. Featured
  3. Πολιτική
  4. Κοινωνία
  5. Οικονομία
  6. Διεθνή Νεα
  7. A1 NEWS TV
  8. life style
  9. Επιστήμη - Τεχνολογία
  10. Πολιτισμός
  11. ΡΕΤΡΟ
  12. Alpha1news
  13. αρτ tv
  14. Πρόσφατα
  15. Κορωνοϊός: Οι μάσκες στα σούπερ μάρκετ υποχρεωτικές μόνον για τους εργαζόμενους
  16. ''H TEXNH ΔΕΝ ΕΙΝΑΙ ΧΟΜΠΥ''- «ΣΤΗΡΙΞΤΕ ΤΟΝ ΠΟΛΙΤΙΣΜΟ» - ΚΑΛΛΙΤΕΧΝΕΣ ΥΠΕΡ ΤΩΝ ΚΑΛΛΙΤΕΧΝΩΝ ..
  17. MAΓΚΥ - ''ΤΟ ΚΟΡΜΙ ΜΙΑΣ ΠΕΝΗΝΤΑΧΡΟΝΗΣ ΠΟΥ ΘΑ ΖΗΛΕΥΑΝ ΕΙΚΟΣΑΡΕΣ''.
  18. Μείωση ενοικίων: Εξι «γιατί» και πέντε προτάσεις της ΠΟΜΙΔΑ για το δίχως τέλος «μνημόσυνο με ξένα κόλλυβα»
  19. ΚΚΕ - «Θυμίζει Κίνα» και «Βόρεια Κορέα»
  20. MAYA PLISETSKAYA - TO ΜΕΓΑΛΟ ΑΣΤΕΡΙ ΤΩΝ ΜΠΑΛΕΤΩΝ ''BOLSHOI''...ΠΕΝΤΕ ΧΡΟΝΙΑ ΧΟΡΕΥΕΙ ΜΕ ΤΟΥΣ ΑΓΓΕΛΟΥΣ...
  21. Σοκ στο παγκόσμιο μπάσκετ: Απεβίωσε στα 60 του χρόνια ο Μαρκ ΜακΝαμάρα
  22. Το ΠΑΜΕ γελοιοποίησε το κράτος – Ευθύνες σε κυβέρνηση, ΕΛ.ΑΣ.
  23. ΤΖΟΥΣ ΕΥΕΙΔΗ - ''ΕΙΝΑΙ ΜΕΓΑΛΟΣ ΚΑΥΜΟΣ Η ΔΟΥΛΕΙΑ ΜΑΣ.ΔΥΣΤΥΧΩΣ ΜΑΣ ΑΝΤΙΜΕΤΩΠΙΖΟΥΝ ΣΑΝ ΑΝΑΛΩΣΙΜΟΥΣ''
  24. ΒΑΓΓΕΛΗΣ ΣΕΙΛΗΝΟΣ - Ο ''ΝΟΥΡΕΓΙΕΦ'' ΤΗΣ ΕΛΛΑΔΑΣ... ΕΦΥΓΕ ΣΤΙΣ 2 ΜΑΙΟΥ 1998... ΗΤΑΝ 62 ΕΤΩΝ...
  25. Επιστήμη - Τεχνολογία
  26. Ιχνηλάτης
  27. Gallery
  28. Social Counter
  29. Αρτ tv Live
  30. art fm 90,6
  31. Facebook
  32. Οι Άγιοι της Πίστεώς μας Γ.Καρατζαφέρη
  33. Πρόσφατα
  34. Σχόλια

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

45 :

Google Adsense

:
pub-1556223355139109

Google Analytics

:
Not Applicable

Links - Internal

61:
  1. Alpha1news Home
    http://www.alpha1news.gr/
  2. http://
    http://
  3. http://www.alpha1news.gr/
    http://www.alpha1news.gr/
  4. Alpha1news ΡΟΗ ΕΙΔΗΣΕΩΝ
    http://www.alpha1news.gr/search?&max-results=8
  5. Alpha1news Πολιτική
    http://www.alpha1news.gr/search/label/%CE%A0%CE%BF%CE%BB%CE%B9%CF%84%CE%B9%CE%BA%CE%AE
  6. Alpha1news Κοινωνία
    http://www.alpha1news.gr/search/label/%CE%9A%CE%BF%CE%B9%CE%BD%CF%89%CE%BD%CE%AF%CE%B1
  7. Alpha1news Διεθνή
    http://www.alpha1news.gr/search/label/%CE%94%CE%B9%CE%B5%CE%B8%CE%BD%CE%AE?&max-results=8
  8. Alpha1news Α1 Web Tv
    http://www.alpha1news.gr/search/label/A1%20NEWS%20TV
  9. Alpha1news LifeStyle
    http://www.alpha1news.gr/search/label/LifeStyle
  10. Alpha1news Πρόσφατα
    http://alpha1news.gr/search?&max-results=8
  11. Alpha1news Περισσότερα
    http://alpha1news.gr/search?&max-results=8
  12. http://www.alpha1news.gr/2020/05/blog-post_92.html
    http://www.alpha1news.gr/2020/05/blog-post_92.html
  13. Alpha1news Κορωνοϊός: Οι μάσκες στα σούπερ μάρκετ υποχρεωτικές μόνον για τους εργαζόμενους
    http://www.alpha1news.gr/2020/05/blog-post_92.html
  14. Alpha1news 2.5.20
    http://www.alpha1news.gr/2020/05/blog-post_92.html
  15. Alpha1news Περισσότερα
    http://www.alpha1news.gr/2020/05/blog-post_92.html
  16. http://www.alpha1news.gr/2020/05/h-texnh.html
    http://www.alpha1news.gr/2020/05/h-texnh.html
  17. Alpha1news Πολιτισμός
    http://www.alpha1news.gr/search/label/%CE%A0%CE%BF%CE%BB%CE%B9%CF%84%CE%B9%CF%83%CE%BC%CF%8C%CF%82
  18. Alpha1news ''H TEXNH ΔΕΝ ΕΙΝΑΙ ΧΟΜΠΥ''- «ΣΤΗΡΙΞΤΕ ΤΟΝ ΠΟΛΙΤΙΣΜΟ» - ΚΑΛΛΙΤΕΧΝΕΣ ΥΠΕΡ ΤΩΝ ΚΑΛΛΙΤΕΧΝΩΝ ..
    http://www.alpha1news.gr/2020/05/h-texnh.html
  19. Alpha1news 2.5.20
    http://www.alpha1news.gr/2020/05/h-texnh.html
  20. Alpha1news Περισσότερα
    http://www.alpha1news.gr/2020/05/h-texnh.html
  21. http://www.alpha1news.gr/2020/05/ma.html
    http://www.alpha1news.gr/2020/05/ma.html
  22. Alpha1news MAΓΚΥ - ''ΤΟ ΚΟΡΜΙ ΜΙΑΣ ΠΕΝΗΝΤΑΧΡΟΝΗΣ ΠΟΥ ΘΑ ΖΗΛΕΥΑΝ ΕΙΚΟΣΑΡΕΣ''.
    http://www.alpha1news.gr/2020/05/ma.html
  23. Alpha1news 2.5.20
    http://www.alpha1news.gr/2020/05/ma.html
  24. Alpha1news Περισσότερα
    http://www.alpha1news.gr/2020/05/ma.html
  25. http://www.alpha1news.gr/2020/05/blog-post_51.html
    http://www.alpha1news.gr/2020/05/blog-post_51.html
  26. Alpha1news Μείωση ενοικίων: Εξι «γιατί» και πέντε προτάσεις της ΠΟΜΙΔΑ για το δίχως τέλος «μνημόσυνο με ξένα κόλλυβα»
    http://www.alpha1news.gr/2020/05/blog-post_51.html
  27. Alpha1news 2.5.20
    http://www.alpha1news.gr/2020/05/blog-post_51.html
  28. Alpha1news Περισσότερα
    http://www.alpha1news.gr/2020/05/blog-post_51.html
  29. http://www.alpha1news.gr/2020/05/blog-post_21.html
    http://www.alpha1news.gr/2020/05/blog-post_21.html
  30. Alpha1news ΚΚΕ - «Θυμίζει Κίνα» και «Βόρεια Κορέα»
    http://www.alpha1news.gr/2020/05/blog-post_21.html
  31. Alpha1news 2.5.20
    http://www.alpha1news.gr/2020/05/blog-post_21.html
  32. Alpha1news Περισσότερα
    http://www.alpha1news.gr/2020/05/blog-post_21.html
  33. http://www.alpha1news.gr/2020/05/maya-plisetskaya-to-bolshoi.html
    http://www.alpha1news.gr/2020/05/maya-plisetskaya-to-bolshoi.html
  34. Alpha1news MAYA PLISETSKAYA - TO ΜΕΓΑΛΟ ΑΣΤΕΡΙ ΤΩΝ ΜΠΑΛΕΤΩΝ ''BOLSHOI''...ΠΕΝΤΕ ΧΡΟΝΙΑ ΧΟΡΕΥΕΙ ΜΕ ΤΟΥΣ ΑΓΓΕΛΟΥΣ...
    http://www.alpha1news.gr/2020/05/maya-plisetskaya-to-bolshoi.html
  35. Alpha1news 2.5.20
    http://www.alpha1news.gr/2020/05/maya-plisetskaya-to-bolshoi.html
  36. Alpha1news Περισσότερα
    http://www.alpha1news.gr/2020/05/maya-plisetskaya-to-bolshoi.html
  37. http://www.alpha1news.gr/2020/05/60.html
    http://www.alpha1news.gr/2020/05/60.html
  38. Alpha1news Σοκ στο παγκόσμιο μπάσκετ: Απεβίωσε στα 60 του χρόνια ο Μαρκ ΜακΝαμάρα
    http://www.alpha1news.gr/2020/05/60.html
  39. Alpha1news 2.5.20
    http://www.alpha1news.gr/2020/05/60.html
  40. Alpha1news Περισσότερα
    http://www.alpha1news.gr/2020/05/60.html
  41. http://www.alpha1news.gr/2020/05/blog-post_95.html
    http://www.alpha1news.gr/2020/05/blog-post_95.html
  42. Alpha1news Το ΠΑΜΕ γελοιοποίησε το κράτος – Ευθύνες σε κυβέρνηση, ΕΛ.ΑΣ.
    http://www.alpha1news.gr/2020/05/blog-post_95.html
  43. Alpha1news 2.5.20
    http://www.alpha1news.gr/2020/05/blog-post_95.html
  44. Alpha1news Περισσότερα
    http://www.alpha1news.gr/2020/05/blog-post_95.html
  45. http://www.alpha1news.gr/2020/05/blog-post_2.html
    http://www.alpha1news.gr/2020/05/blog-post_2.html
  46. Alpha1news ΤΖΟΥΣ ΕΥΕΙΔΗ - ''ΕΙΝΑΙ ΜΕΓΑΛΟΣ ΚΑΥΜΟΣ Η ΔΟΥΛΕΙΑ ΜΑΣ.ΔΥΣΤΥΧΩΣ ΜΑΣ ΑΝΤΙΜΕΤΩΠΙΖΟΥΝ ΣΑΝ ΑΝΑΛΩΣΙΜΟΥΣ''
    http://www.alpha1news.gr/2020/05/blog-post_2.html
  47. Alpha1news 2.5.20
    http://www.alpha1news.gr/2020/05/blog-post_2.html
  48. Alpha1news Περισσότερα
    http://www.alpha1news.gr/2020/05/blog-post_2.html
  49. http://www.alpha1news.gr/2020/05/2-1998-62.html
    http://www.alpha1news.gr/2020/05/2-1998-62.html
  50. Alpha1news ΡΕΤΡΟ
    http://www.alpha1news.gr/search/label/%CE%A1%CE%95%CE%A4%CE%A1%CE%9F
  51. Alpha1news ΒΑΓΓΕΛΗΣ ΣΕΙΛΗΝΟΣ - Ο ''ΝΟΥΡΕΓΙΕΦ'' ΤΗΣ ΕΛΛΑΔΑΣ... ΕΦΥΓΕ ΣΤΙΣ 2 ΜΑΙΟΥ 1998... ΗΤΑΝ 62 ΕΤΩΝ...
    http://www.alpha1news.gr/2020/05/2-1998-62.html
  52. Alpha1news 2.5.20
    http://www.alpha1news.gr/2020/05/2-1998-62.html
  53. Alpha1news Περισσότερα
    http://www.alpha1news.gr/2020/05/2-1998-62.html
  54. Alpha1news Παλαιότερες αναρτήσεις
    http://www.alpha1news.gr/search?updated-max=2020-05-02T02:36:00%2B03:00&max-results=10
  55. Alpha1news Αρχική σελίδα
    http://www.alpha1news.gr/
  56. Alpha1news Αναρτήσεις ( Atom )
    http://www.alpha1news.gr/feeds/posts/default
  57. http://www.alpha1news.gr/2020/02/13.html
    http://www.alpha1news.gr/2020/02/13.html
  58. Alpha1news ΣΤΑΜΑΤΗΣ ΓΟΝΙΔΗΣ - ΚΑΤΕΡΙΝΑ ΚΟΥΡΓΙΟΥΞΙΔΟΥ -13 ΧΡΟΝΙΑ ΜΑΖΙ ΚΑΙ ΕΥΤΥΧΙΣΜΕΝΟΙ...
    http://www.alpha1news.gr/2020/02/13.html
  59. http://www.alpha1news.gr/2018/04/2018_26.html
    http://www.alpha1news.gr/2018/04/2018_26.html
  60. Alpha1news ΜΙΧΑΛΗΣ ΛΕΑΝΗΣ-ΑΘΛΗΤΙΚΟΣ ΔΗΜΟΣΙΟΓΡΑΦΟΣ ΚΑΙ ΥΠΟΨΗΦΙΟΣ ΒΟΥΛΕΥΤΗΣ Α' ΠΕΙΡΑΙΑ ΜΕ ΤΟ ΚΚΕ . .ΑΡΧΕΣ ΙΟΥΝΙΟΥ 2018 ΠΑΝΤΡΕΥΕΤΑΙ ΜΕ ΠΟΛΙΤΙΚΟ ΓΑΜΟ ΣΤΟΝ ΠΕΙΡΑΙΑ Ο ΠΡΩΗΝ ΣΥΖΥΓΟΣ ΤΗΣ ΔΗΜΟΣΙΟΓΡΑΦΟΥ ΣΙΑΣ ΚΟΣΣΙΩΝΗ
    http://www.alpha1news.gr/2018/04/2018_26.html
  61. http://alpha1news.gr/
    http://alpha1news.gr/

Links - Internal (nofollow)

0:

Links - Outbound

42:
  1. Alpha1news art tv live
    http://www.arttv.info/2014/03/art-tv-live.html
  2. Alpha1news tilesport.tv
    http://www.tilesport.tv/index_live.php
  3. Alpha1news betweekend
    http://betweekend.gr/
  4. Alpha1news art fm 906
    http://www.artfm906.gr/
  5. Alpha1news Sports News
    http://www.tilesport.tv/index_live.php
  6. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML1&action=editWidget§ionId=ticker
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML1&action=editWidget§ionId=ticker
  7. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML2&action=editWidget§ionId=featured-sec
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML2&action=editWidget§ionId=featured-sec
  8. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML3&action=editWidget§ionId=box-sec
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML3&action=editWidget§ionId=box-sec
  9. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML6&action=editWidget§ionId=box-sec
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML6&action=editWidget§ionId=box-sec
  10. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML15&action=editWidget§ionId=box-sec
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML15&action=editWidget§ionId=box-sec
  11. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML20&action=editWidget§ionId=box-sec
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML20&action=editWidget§ionId=box-sec
  12. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML27&action=editWidget§ionId=box-sec
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML27&action=editWidget§ionId=box-sec
  13. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML4&action=editWidget§ionId=box-sec
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML4&action=editWidget§ionId=box-sec
  14. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML21&action=editWidget§ionId=box-sec
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML21&action=editWidget§ionId=box-sec
  15. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML28&action=editWidget§ionId=box-sec
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML28&action=editWidget§ionId=box-sec
  16. Alpha1news mixalistamou
    https://www.blogger.com/profile/03083426374458186814
  17. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML7&action=editWidget§ionId=box-sec2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML7&action=editWidget§ionId=box-sec2
  18. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML5&action=editWidget§ionId=box-sec2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML5&action=editWidget§ionId=box-sec2
  19. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML8&action=editWidget§ionId=box-sec2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML8&action=editWidget§ionId=box-sec2
  20. Alpha1news facebook count=5.3k;Followers
    https://www.facebook.com/ARTTHLEORASH/
  21. Alpha1news twitter count=1.7k;Followers
    https://twitter.com/alpha1news
  22. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML14&action=editWidget§ionId=sidebar2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML14&action=editWidget§ionId=sidebar2
  23. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML13&action=editWidget§ionId=sidebar2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML13&action=editWidget§ionId=sidebar2
  24. Alpha1news Αρτ τηλεόραση - ART TV
    https://www.facebook.com/ARTTHLEORASH/
  25. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML23&action=editWidget§ionId=sidebar2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML23&action=editWidget§ionId=sidebar2
  26. Alpha1news πρωτοσέλιδα
    https://www.frontpages.gr
  27. Alpha1news εφημερίδων
    https://www.frontpages.gr
  28. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML18&action=editWidget§ionId=sidebar2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML18&action=editWidget§ionId=sidebar2
  29. Alpha1news Αρτ τηλεόραση - ART TV
    https://www.facebook.com/ARTTHLEORASH
  30. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML22&action=editWidget§ionId=sidebar2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML22&action=editWidget§ionId=sidebar2
  31. https://www.tvforum.gr/2018/10/kompoloi-portofoli.html
    https://www.tvforum.gr/2018/10/kompoloi-portofoli.html
  32. https://www.tvforum.gr/2018/05/double-reaction-champions-tv-forum.html
    https://www.tvforum.gr/2018/05/double-reaction-champions-tv-forum.html
  33. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML26&action=editWidget§ionId=sidebar2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML26&action=editWidget§ionId=sidebar2
  34. https://drive.google.com/open?id=1EGPA8PhRr7j-1mLMm_P91dJFq3eJWP2K
    https://drive.google.com/open?id=1EGPA8PhRr7j-1mLMm_P91dJFq3eJWP2K
  35. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML30&action=editWidget§ionId=sidebar2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML30&action=editWidget§ionId=sidebar2
  36. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML10&action=editWidget§ionId=tabside1
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML10&action=editWidget§ionId=tabside1
  37. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML12&action=editWidget§ionId=tabside2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML12&action=editWidget§ionId=tabside2
  38. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML16&action=editWidget§ionId=footer-sec1
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML16&action=editWidget§ionId=footer-sec1
  39. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=PopularPosts&widgetId=PopularPosts2&action=editWidget§ionId=footer-sec2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=PopularPosts&widgetId=PopularPosts2&action=editWidget§ionId=footer-sec2
  40. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML17&action=editWidget§ionId=footer-sec3
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML17&action=editWidget§ionId=footer-sec3
  41. Alpha1news ThemeXpose
    http://www.themexpose.com/
  42. Alpha1news Gooyaabi Templates
    https://gooyaabitemplates.com/

Links - Outbound (nofollow)

25:
  1. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML1&action=editWidget§ionId=ticker
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML1&action=editWidget§ionId=ticker
  2. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML2&action=editWidget§ionId=featured-sec
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML2&action=editWidget§ionId=featured-sec
  3. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML3&action=editWidget§ionId=box-sec
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML3&action=editWidget§ionId=box-sec
  4. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML6&action=editWidget§ionId=box-sec
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML6&action=editWidget§ionId=box-sec
  5. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML15&action=editWidget§ionId=box-sec
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML15&action=editWidget§ionId=box-sec
  6. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML20&action=editWidget§ionId=box-sec
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML20&action=editWidget§ionId=box-sec
  7. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML27&action=editWidget§ionId=box-sec
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML27&action=editWidget§ionId=box-sec
  8. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML4&action=editWidget§ionId=box-sec
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML4&action=editWidget§ionId=box-sec
  9. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML21&action=editWidget§ionId=box-sec
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML21&action=editWidget§ionId=box-sec
  10. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML28&action=editWidget§ionId=box-sec
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML28&action=editWidget§ionId=box-sec
  11. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML7&action=editWidget§ionId=box-sec2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML7&action=editWidget§ionId=box-sec2
  12. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML5&action=editWidget§ionId=box-sec2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML5&action=editWidget§ionId=box-sec2
  13. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML8&action=editWidget§ionId=box-sec2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML8&action=editWidget§ionId=box-sec2
  14. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML14&action=editWidget§ionId=sidebar2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML14&action=editWidget§ionId=sidebar2
  15. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML13&action=editWidget§ionId=sidebar2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML13&action=editWidget§ionId=sidebar2
  16. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML23&action=editWidget§ionId=sidebar2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML23&action=editWidget§ionId=sidebar2
  17. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML18&action=editWidget§ionId=sidebar2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML18&action=editWidget§ionId=sidebar2
  18. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML22&action=editWidget§ionId=sidebar2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML22&action=editWidget§ionId=sidebar2
  19. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML26&action=editWidget§ionId=sidebar2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML26&action=editWidget§ionId=sidebar2
  20. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML30&action=editWidget§ionId=sidebar2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML30&action=editWidget§ionId=sidebar2
  21. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML10&action=editWidget§ionId=tabside1
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML10&action=editWidget§ionId=tabside1
  22. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML12&action=editWidget§ionId=tabside2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML12&action=editWidget§ionId=tabside2
  23. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML16&action=editWidget§ionId=footer-sec1
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML16&action=editWidget§ionId=footer-sec1
  24. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=PopularPosts&widgetId=PopularPosts2&action=editWidget§ionId=footer-sec2
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=PopularPosts&widgetId=PopularPosts2&action=editWidget§ionId=footer-sec2
  25. //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML17&action=editWidget§ionId=footer-sec3
    //www.blogger.com/rearrange?blogID=8760841790902171574&widgetType=HTML&widgetId=HTML17&action=editWidget§ionId=footer-sec3

Keyword Cloud for Alpha1news.gr

widgetmanagerregisterwidgetlinklistviewfacebookart tv0171 1871998 62displaymodefull widgetmanagerregisterwidgethtmlview2boxsec187 reviewedpinteresttwitterfjshome2 1998windowcookieoptions2520 rating 5artnewslive1maya plisetskayafalsevarhttpwwwalpha1newsgr9option171 187 mixalistamou2520187 171reviewedobjectgetownpropertynamesthisfunctiontypeofsharemessageplisetskayareviewed by mixalistamoutitlex3dx22alpha1newsfalse8171 187 reviewed6keydatamixalistamou on 2520171 187 171name4boxsec2truejsalpha1newsmixalistamou2520 rating2 1998 62blogthisurldisplaymodefullnew187 mixalistamou2520tvwidgetmanagerregisterwidgethtmlview new160 160 160160 1603ratingsidebar210plisetskaya to bolshoidisplaymodefull widgetmanagerregisterwidgetlinklistview newtv livemaidwidgetmanagerregisterwidgetlinklistview newdisplaymodefull widgetmanagerregisterwidgethtmlview newtargetwidgetmanagerregisterwidgethtmlviewtexnh5varmixalistamou25207bolshoirating 5maya187 171 187displaymodefull widgetmanagerregisterwidgetlinklistviewmain1 news

Longtail Keyword Density for Alpha1news.gr

KeywordsOccurences
displaymodefull widgetmanagerregisterwidgethtmlview new35
160 160 16025
reviewed by mixalistamou10
mixalistamou on 252010
2520 rating 510
displaymodefull widgetmanagerregisterwidgetlinklistview new5
171 187 mixalistamou25203
171 187 reviewed3
171 187 1713
187 171 1873
plisetskaya to bolshoi3
2 1998 623
widgetmanagerregisterwidgethtmlview new36
displaymodefull widgetmanagerregisterwidgethtmlview35
160 16028
2520 rating10
rating 510
171 18710
widgetmanagerregisterwidgetlinklistview new5
displaymodefull widgetmanagerregisterwidgetlinklistview5
maya plisetskaya4
1998 623
art tv3
2 19983
187 1713
tv live3
187 mixalistamou25203
1 news3
187 reviewed3
new44
displaymodefull44
widgetmanagerregisterwidgethtmlview36
031
false19
name18
box-sec13
111
var10
210
mixalistamou252010
reviewed10
true10
310
rating10
410
mixalistamou10
url9
tv9
sidebar27
target6
sharemessage6
key6
option6
facebook6
55
data5
news5
art5
twitter5
65
widgetmanagerregisterwidgetlinklistview5
httpwwwalpha1newsgr5
74
maya4
plisetskaya4
windowcookieoptions4
pinterest4
objectgetownpropertynamesthisfunctiontypeof4
fjs4
js4
id4
alpha1news4
live3
main3
box-sec23
titlex3dx22alpha1news3
falsevar3
blogthis3
texnh3
ma3
83
bolshoi3
93
103
home3

Who hosts Alpha1news.gr?

Alpha1news.gr Hosting Provider Information

Hosted IP Address:216.239.38.21
Hosted Hostname:any-in-2615.1e100.net
Service Provider:Google Inc.
Hosted Country:MexicoMX
Location Latitude:19.3421
Location Longitude:-99.1927
Webserver Software:GSE

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%

HTTP Header Analysis for Alpha1news.gr

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html; charset=UTF-8
Expires: Thu, 22 Oct 2020 12:23:20 GMT
Date: Thu, 22 Oct 2020 12:23:20 GMT
Cache-Control: private, max-age=0
Last-Modified: Thu, 22 Oct 2020 09:00:04 GMT
ETag: W/"8db7e32eac683d926f424f4f3a7b16ff98ad2270b8f5af3bae7a48d698cb4d6c"
Content-Encoding: gzip
X-Content-Type-Options: nosniff
X-XSS-Protection: 1; mode=block
Content-Length: 55670
Server: GSE

Alpha1news.gr Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts Alpha1news.gr?


Domain Registration (WhoIs) information for Alpha1news.gr

Websites with Similar Names

Alpha--imaging.com
Error 404 (Not Found)!!1
Alpha-01.com
Alpha 01 Supplements– Alpha Zero One
Alpha-1-plus.com
alpha-1-plus.com - Registered at Namecheap.com
Alpha-1.co.jp
HOTEL α-1(ホテル・アルファ-ワン)|全国ネットワークのビジネスホテルチェーン|ビジネスホテル・観光ホテル・ホテル予約
Alpha-11.net
Account Suspended
Alpha-1foundation.org
Domain Default page
Alpha-2.info
alpha-2.info -
Alpha-2c.com
Site en construction

Recently Updated Websites

Permanent-rocket.ru 1 second ago.Mein-personaler.at 6 seconds ago.Mynutribox.com 8 seconds ago.Mreymont.cl 9 seconds ago.Louisvilleweddingmusicians.com 9 seconds ago.Pspporntube.com 10 seconds ago.Kacomponents.com 11 seconds ago.Skirope.com 12 seconds ago.Theorganicriot.com 12 seconds ago.Abodekerala.com 15 seconds ago.The-engineers.com 16 seconds ago.Krstian.com 17 seconds ago.Icha.net 20 seconds ago.Blairpark.com 21 seconds ago.Kionforklift.net 23 seconds ago.Cntr.jp 24 seconds ago.Jameshollowaysr.com 25 seconds ago.Oxyelements.com 25 seconds ago.Travelkami.com 29 seconds ago.Agrosilos.ru 29 seconds ago.Byyorge.com 29 seconds ago.Wordsup.co.uk 29 seconds ago.Laboomistanbul.com 32 seconds ago.Zgfadianjizu.com 32 seconds ago.Openreferral.org 33 seconds ago.Anshitelecom.com 33 seconds ago.Rhoa.org 33 seconds ago.Smartpumps.co.in 36 seconds ago.Pure360.co.uk 37 seconds ago.Mikkel.dk 38 seconds ago.