alpha Technik - HIGHTECH. BRANDS. PARTS.

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-10

Wir l(i)eben Motorrad!​ alpha Technik ist dein Partner für Bike-Zubehör, Verschleißteile und Dienstleistungen rund ums Motorrad.


Domain summary

Domain label
alphatechnik
Domain extension
de
Global Traffic Rank
0
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is alphatechnik.de ranked relative to other sites:

Percentage of visits to alphatechnik.de from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Alphatechnik.de registered?
A: Alphatechnik.de was registered 4 months, 2 weeks, 2 days, 18 hours, 54 minutes, 35 seconds ago on Saturday, October 10, 2020.
Q: When was the WHOIS for Alphatechnik.de last updated?
A: The WHOIS entry was last updated 11 years, 4 months, 2 weeks, 6 days, 18 hours, 54 minutes, 35 seconds ago on Tuesday, October 6, 2009.
Q: What are Alphatechnik.de's nameservers?
A: DNS for Alphatechnik.de is provided by the following nameservers:
  • dns.ronet.de
  • dns2.ronet.de
Q: Who is the registrar for the Alphatechnik.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Alphatechnik.de?
A: Alphatechnik.de has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Alphatechnik.de each day?
A: Alphatechnik.de receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Alphatechnik.de resolve to?
A: Alphatechnik.de resolves to the IPv4 address 185.214.120.184.
Q: In what country are Alphatechnik.de servers located in?
A: Alphatechnik.de has servers located in the Germany.
Q: What webserver software does Alphatechnik.de use?
A: Alphatechnik.de is powered by Apache webserver.
Q: Who hosts Alphatechnik.de?
A: Alphatechnik.de is hosted by Fara Negar Pardaz Khuzestan in Bavaria, Rosenheim, Germany, 83026.
Q: How much is Alphatechnik.de worth?
A: Alphatechnik.de has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Alphatechnik.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Alphatechnik.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Alphatechnik.de

H1 Headings

1 :
  1. Willkommen bei alpha Technik!HIGHTECH. BRANDS. PARTS.

H2 Headings

15 :
  1. Wir l(i)eben Motorrad!​
  2. Top-Marken bei alpha Technik
  3. News
  4. alpha Technik Service
  5. Fahrwerksservice
  6. Fahrwerk Reparatur
  7. Unabhängig, mobil und frei sein.
  8. Dunkler Sound & formvollendetes Design
  9. Optimieren, aber richtig.
  10. Fahrwerkstechnik
  11. Auf Details kommt es an!
  12. Wartung - Inspektion - Reparatur
  13. Elektrik & Elektronik
  14. Werkstatt & Box
  15. DIE BESTEN MARKEN FÜR DEIN BIKE.

H3 Headings

16 :
  1. Akrapovič
  2. Öhlins
  3. Arrow
  4. alpha Technik
  5. Bitubo
  6. Barracuda
  7. Wilbers
  8. dguard E-Call System
  9. alpha Technik Mofaumrüstung für Sherco 50 SM-R
  10. O’Zapft is! Wilbers Oktoberfest!
  11. alpha Technik Kennzeichenhalter für Ducati Scrambler 1100 Pro und Sport Pro ab Modelljahr 2020
  12. alpha Technik Kennzeichenhalter für KTM 690 SMC R ab Modelljahr 2019
  13. Auspuffanlagen der Marke Arrow für Yamaha YZF-R1 2017-2020
  14. Arrow Exhaust für KTM 1290 Super Duke R 2020
  15. Der alpha Technik Mund-Nasen-Schutz
  16. alpha Technik 35 kW (48 PS) Leistungsänderung (MCR) für Kawasaki Vulcan S ab BJ 2017

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

122 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-10721529-6

Links - Internal

115:

Links - Internal (nofollow)

0:

Links - Outbound

42:

Keyword Cloud for Alphatechnik.de

unternehmen unternehmensprofil entstehungsgeschichte8211 bmw emilracing historie alphaheljobs servicefindesthlinsauspufftechnikstahlflexleitungen hel tieferlegungendesignentstehungsgeschichte mitarbeiter importeurebremse fahrwerk anbaushopfahrwerkvonweitervieletieferlegungentuning auspufftechnik bremsentechnikvan zon 8211tuning auspufftechnikrapid bikefelgen zubehr abe8217shel tieferlegungen2020 alpharacing 8211 vanfahrwerkstechnik reifen 8211hndler partner kontaktreifen 8211 felgenstahlflexleitungen0homepartnervombis hinvan zonflickrabbremsefahrwerkstechnik reifenreparaturanfrage fahrwerksservice fhrerscheinrichtliniealpha technikseptember 2020mitarbeiterkannpartner kontakt homepartner kontaktkontaktpartsbrems und kupplungshebelservice racing racingemil weberservice racingleistungsnderungen tuningbremsentechnik fahrwerk stahlflexleitungenunternehmensprofil entstehungsgeschichte1rapidhinauspufftechnik bremsentechnikracing racingreparaturanfrage fahrwerksserviceperformancebisformulare info alphaunternehmen unternehmensprofilleistung auspuffauspufftechnik bremsentechnik fahrwerkstechnikfr deinauspuffelektrikunshel tieferlegungen formularealpha technik serviceteam bilderdeinverwendungslistenbike servicepartner bitubofahrwerk anbauzonverschlei elektrikzurmotos team bilderstahlflexleitungen helfahrwerkstechnikanbau verschlei elektrikformulare infotieferlegungen formulare infowerdenobelektrik boxdaselektrik box dguardemil weber motosvon alpha technikinfobremsentechnik fahrwerkstechnikservicepartnerzu batterienleistung auspuff bremsebremse fahrwerkneueimporteure jobsdguardservice rapid bikebitubo reparaturanfrage fahrwerksservicebikeemil8211 van zonflickr downloads verwendungslistenanbaureparaturanfrageunternehmensprofilformularefahrwerk anbau verschleireifen 8211tieferlegungen formularehinweise zufahrwerksservicebarracudamotos teammarkeservice rapidjobsbox dguardshop leistung auspuffhistorieflickr downloadsnews unternehmen unternehmensprofilmitinfo alpha technikjobs service racingnewszu batterien hndlermotorrad2020 alpha technikweber motos teamdownloads verwendungslistenfahrwerksservice fhrerscheinrichtlinie hinweiseabe8217sbremsentechnikvon alphabilder flickr downloadsalphahome shopbeialpha racing 8211bilder flickrberbike servicepartnerfahrwerksservice fhrerscheinrichtliniezubehrkupplungshebel 8222alpha racing8220furastenanlagen bremsentechnik fahrwerkzurck weiterbremsentechnik fahrwerkwirdguard news unternehmenracing8220 furastenanlagenfhrerscheinrichtlinie8211 felgen zubehrdenbmw emilstahlflexleitungen at stahlflexleitungentuningbremsentechnik fahrwerkstechnik reifenabe8217s bremsderteambituboarbeitenreifenservicepartner bitubohndlerzon 8211technikzon 8211 bmwbatterieneinbatterien hndler partnerimporteurevaninfo alphadownloadsmotosanbau verschleiwilbershistorie alphaverschlei elektrik boxnews unternehmenverwendungslisten leistungsnderungen tuningshop leistungracing racing historieausdiehinweisedguard newskupplungshebel 8222alphateam bilder flickrkennzeichenhalterbmw emil weber8222alpha racing8220 furastenanlagenbrems8222alpha racing8220servicepartner bitubo reparaturanfragedubilderzuracingzurckfindest dufelgen zubehrhistorie alpha racingarrow8211 felgenfhrerscheinrichtlinie hinweiseimporteure jobs serviceleistungauspuff bremseaufracing historieverwendungslisten leistungsnderungenunternehmensprofil entstehungsgeschichte mitarbeiterseptemberzumunternehmenfahrwerk stahlflexleitungen8211 vanhndler partnerhome shop leistungfurastenanlagenkupplungshebelbatterien hndlerentstehungsgeschichte mitarbeiterscooterleistungsnderungen tuning auspufftechnik8211 bmwracing8220 furastenanlagen bremsentechnikserviceesentstehungsgeschichteracing8220weber motoshinweise zu batteriensound8222alphafhrerscheinrichtlinie hinweise zumitarbeiter importeurerapid bike servicepartnerbitubo reparaturanfragemitarbeiter importeure jobsbox dguard newsbmwracing 8211leistungsnderungenfurastenanlagen bremsentechnikboxverschleialpha racingauspuff bremse fahrwerkfroderfelgenzubehr abe8217s bremszubehr abe8217sbestentechnik servicekontakt home shopsichweberkontakt hometechnik service rapiddownloads verwendungslisten leistungsnderungen

Longtail Keyword Density for Alphatechnik.de

KeywordsOccurences
alpha technik service7
team bilder flickr7
hinweise zu batterien7
home shop leistung6
kupplungshebel 8222alpha racing82206
bremsentechnik fahrwerk stahlflex-leitungen6
furastenanlagen bremsentechnik fahrwerk6
racing8220 furastenanlagen bremsentechnik6
8222alpha racing8220 furastenanlagen6
zubehr abe8217s brems-6
brems- und kupplungshebel6
stahlflex-leitungen hel tieferlegungen6
felgen zubehr abe8217s6
8211 felgen zubehr6
reifen 8211 felgen6
fahrwerkstechnik reifen 82116
bremsentechnik fahrwerkstechnik reifen6
stahlflex-leitungen at stahlflex-leitungen6
tieferlegungen formulare info6
hel tieferlegungen formulare6
bitubo reparatur-anfrage fahrwerksservice6
hndler partner kontakt6
batterien hndler partner6
zu batterien hndler6
fhrerscheinrichtlinie hinweise zu6
fahrwerksservice fhrerscheinrichtlinie hinweise6
reparatur-anfrage fahrwerksservice fhrerscheinrichtlinie6
servicepartner bitubo reparatur-anfrage6
shop leistung auspuff6
bike servicepartner bitubo6
rapid bike servicepartner6
service rapid bike6
technik service rapid6
info alpha technik6
formulare info alpha6
auspufftechnik bremsentechnik fahrwerkstechnik6
tuning auspufftechnik bremsentechnik6
leistungsnderungen tuning auspufftechnik6
box dguard news6
mitarbeiter importeure jobs6
entstehungsgeschichte mitarbeiter importeure6
unternehmensprofil entstehungsgeschichte mitarbeiter6
unternehmen unternehmensprofil entstehungsgeschichte6
news unternehmen unternehmensprofil6
dguard news unternehmen6
elektrik box dguard6
verwendungslisten leistungsnderungen tuning6
verschlei elektrik box6
anbau verschlei elektrik6
fahrwerk anbau verschlei6
bremse fahrwerk anbau6
auspuff bremse fahrwerk6
leistung auspuff bremse6
importeure jobs service6
jobs service racing6
service racing racing6
racing racing historie6
downloads verwendungslisten leistungsnderungen6
flickr downloads verwendungslisten6
bilder flickr downloads6
motos team bilder6
weber motos team6
emil weber motos6
bmw emil weber6
8211 bmw emil6
zon 8211 bmw6
van zon 82116
8211 van zon6
racing 8211 van6
alpha racing 82116
historie alpha racing6
racing historie alpha6
2020 alpha technik4
partner kontakt home3
kontakt home shop3
von alpha technik3
alpha technik21
bremsentechnik fahrwerkstechnik7
rapid bike7
bilder flickr7
zu batterien7
hinweise zu7
team bilder7
technik service7
alpha racing7
fahrwerk stahlflex-leitungen6
bremsentechnik fahrwerk6
furastenanlagen bremsentechnik6
abe8217s brems-6
racing8220 furastenanlagen6
8222alpha racing82206
kupplungshebel 8222alpha6
zubehr abe8217s6
felgen zubehr6
8211 felgen6
reifen 82116
stahlflex-leitungen hel6
formulare info6
hel tieferlegungen6
tieferlegungen formulare6
shop leistung6
info alpha6
service rapid6
bike servicepartner6
servicepartner bitubo6
bitubo reparatur-anfrage6
reparatur-anfrage fahrwerksservice6
fahrwerksservice fhrerscheinrichtlinie6
fhrerscheinrichtlinie hinweise6
batterien hndler6
hndler partner6
partner kontakt6
september 20206
fahrwerkstechnik reifen6
home shop6
auspufftechnik bremsentechnik6
box dguard6
tuning auspufftechnik6
entstehungsgeschichte mitarbeiter6
unternehmensprofil entstehungsgeschichte6
unternehmen unternehmensprofil6
news unternehmen6
dguard news6
elektrik box6
jobs service6
verschlei elektrik6
anbau verschlei6
fahrwerk anbau6
bremse fahrwerk6
auspuff bremse6
leistung auspuff6
importeure jobs6
mitarbeiter importeure6
service racing6
emil weber6
leistungsnderungen tuning6
verwendungslisten leistungsnderungen6
downloads verwendungslisten6
flickr downloads6
racing racing6
weber motos6
motos team6
bmw emil6
8211 bmw6
zon 82116
van zon6
8211 van6
racing 82116
historie alpha6
racing historie6
2020 alpha4
bis hin4
kontakt home3
von alpha3
findest du3
fr dein3
zurck weiter3
fr30
alpha29
technik21
021
racing20
shop19
bremsentechnik15
fahrwerk15
die13
service13
zu13
stahlflex-leitungen12
111
bike11
oder10
bitubo10
hel9
fahrwerkstechnik9
flickr9
auf9
elektrik9
der9
von9
box8
dguard8
leistung8
den8
du8
news8
info7
tieferlegungen7
auspuff7
bremse7
fahrwerksservice7
brems-7
zubehr7
hinweise7
batterien7
hndler7
partner7
kontakt7
bilder7
team7
rapid7
bmw7
dein7
zum6
bis6
fhrerscheinrichtlinie6
arrow6
home6
servicepartner6
wilbers6
september6
reparatur-anfrage6
formulare6
weber6
anbau6
verschlei6
unternehmen6
unternehmensprofil6
entstehungsgeschichte6
mitarbeiter6
importeure6
jobs6
furastenanlagen6
historie6
van6
zon6
emil6
motos6
reifen6
tuning6
felgen6
leistungsnderungen6
verwendungslisten6
downloads6
abe8217s6
kupplungshebel6
8222alpha6
racing82206
auspufftechnik6
ein5
mit5
design5
das5
wir5
bei5
hin4
ab4
kann4
motorrad4
scooter4
marke4
hlins4
zur4
uns4
findest3
werden3
ber3
zurck3
neue3
weiter3
sich3
performance3
ob3
aus3
kennzeichenhalter3
besten3
viele3
vom3
sound3
es3
parts3
barracuda3
arbeiten3

Who hosts Alphatechnik.de?

Alphatechnik.de Hosting Provider Information

Hosted IP Address:185.214.120.184
Hosted Hostname:web13.ronet.de
Service Provider:Fara Negar Pardaz Khuzestan
Hosted Country:GermanyDE
Location Latitude:47.8388
Location Longitude:12.1032
Webserver Software:Apache

Is "Fara Negar Pardaz Khuzestan" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
Fara Negar Pardaz Khuzestan
1.4862%

HTTP Header Analysis for Alphatechnik.de

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Sat, 10 Oct 2020 00:43:55 GMT
Server: Apache
X-Powered-By: PHP/7.3.16
X-Redirect-By: WordPress
Vary: Accept-Encoding
Upgrade: h2,h2c
Connection: Upgrade
Location: https://alphatechnik.de/
Cache-Control: max-age=0
Expires: Sat, 10 Oct 2020 00:43:55 GMT
Content-Length: 0
Content-Type: text/html; charset=UTF-8

Alphatechnik.de Domain Nameserver Information

HostIP AddressCountry
dns.ronet.de 185.214.120.2
dns2.ronet.de 159.69.243.233


Need to find out who hosts Alphatechnik.de?


Domain Registration (WhoIs) information for Alphatechnik.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: alphatechnik.de
Nserver: dns.ronet.de
Nserver: dns2.ronet.de
Status: connect
Changed: 2009-10-06T14:56:20+02:00

Websites with Similar Names

Alpha--imaging.com
Error 404 (Not Found)!!1
Alpha-01.com
Alpha 01 Supplements– Alpha Zero One
Alpha-1-plus.com
alpha-1-plus.com - Registered at Namecheap.com
Alpha-1.co.jp
HOTEL α-1(ホテル・アルファ-ワン)|全国ネットワークのビジネスホテルチェーン|ビジネスホテル・観光ホテル・ホテル予約
Alpha-1.online
Alpha One Flight Services
Alpha-1.us
alpha-1.us is for sale
Alpha-11.net
Account Suspended
Alpha-1999.jp
【公式】家庭教師のアルファ

Recently Updated Websites

Mervsforallthegoodstuff.com (2 seconds ago.)Sablgrey.com (5 seconds ago.)Analoghatchery.com (6 seconds ago.)Geneticcounsellingaustralia.life (8 seconds ago.)Purelaine.com (8 seconds ago.)Jackiestarr.com (8 seconds ago.)52recipesforstudents.com (10 seconds ago.)Head.solutions (11 seconds ago.)Wesswess.com (11 seconds ago.)6784558.com (16 seconds ago.)Bsgcontractors.com (17 seconds ago.)Entr-hdbk.net (18 seconds ago.)Shrt.run (19 seconds ago.)Skillz4you.com (21 seconds ago.)Buynow4cash.com (22 seconds ago.)Confettiornot.com (24 seconds ago.)Rikisaku.com (28 seconds ago.)Networkcarpet.us (34 seconds ago.)Xr1534.com (36 seconds ago.)Autumnvibe.com (38 seconds ago.)Inspiretotalfitness.com (40 seconds ago.)Boazjamessnyder.net (40 seconds ago.)Flamananas.com (43 seconds ago.)Equipedu.com (44 seconds ago.)Healthyforhisglory.info (45 seconds ago.)Propad.com (48 seconds ago.)Populationonegame.com (48 seconds ago.)Dyromis.com (48 seconds ago.)Funniestsocialmediavideos.com (49 seconds ago.)Osteoreadyeducation.com (49 seconds ago.)

Recently Searched Keywords

science-fiction studies (2 seconds ago.)2 cách bảo quản tôm khô chuẩn – chỉ dân trong nghề mới biếttôm khô là một nguyên liệu khá phổ biến, chế biến được rất nhiều món ăn ngon ... (5 seconds ago.)tianbo (7 seconds ago.)newspeed-pro-content-blocks-1 (11 seconds ago.)content (18 seconds ago.)wireless streaming (19 seconds ago.)welcome to people security services (20 seconds ago.)kora star live (21 seconds ago.)total of 28 (22 seconds ago.)style-jvto74ydactivestyle-jvto74yditemstyle-jvto74yddark style-jvto74ydlink (23 seconds ago.)style-kf4jen6omenucontainer (24 seconds ago.)show me your love lyrics (26 seconds ago.)bordeaux 43 rue (26 seconds ago.)ramin bayramli wiki (26 seconds ago.)todos (26 seconds ago.)woollybear travels (27 seconds ago.)besoin (28 seconds ago.)ngy mua (29 seconds ago.)правила Ñ�айта (31 seconds ago.)med (31 seconds ago.)ngy gpvl (32 seconds ago.)2 cách bảo quản tôm khô chuẩn – chỉ dân trong nghề mới biếttôm khô là một nguyên liệu khá phổ biến, chế biến được rất nhiều món ăn ngon ... (39 seconds ago.)border-stylesolid (40 seconds ago.)flo print (41 seconds ago.)robber (47 seconds ago.)il caffeismo (50 seconds ago.)by hook or by book (52 seconds ago.)15 replies (55 seconds ago.)2 buns (1 minute 1 second ago.)jorge bischoff (1 minute 1 second ago.)