Hikmah Al-Quran & Mutiara Hadits

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-11-03

Hikmah Al-Qur'an dan Mutiara Hadits


Domain summary

Domain label
alsofwah
Domain extension
or.id
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is alsofwah.or.id ranked relative to other sites:

Percentage of visits to alsofwah.or.id from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Alsofwah.or.id registered?
A: Alsofwah.or.id was registered 3 months, 4 weeks, 13 hours, 29 minutes, 51 seconds ago on Tuesday, November 3, 2020.
Q: When was the WHOIS for Alsofwah.or.id last updated?
A: The WHOIS entry was last updated 3 months, 4 weeks, 13 hours, 29 minutes, 51 seconds ago on Tuesday, November 3, 2020.
Q: Who is the registrar for the Alsofwah.or.id domain?
A: The domain has been registered at .
Q: What is the traffic rank for Alsofwah.or.id?
A: Alsofwah.or.id has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Alsofwah.or.id each day?
A: Alsofwah.or.id receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Alsofwah.or.id resolve to?
A: Alsofwah.or.id resolves to the IPv4 address 104.237.50.195.
Q: In what country are Alsofwah.or.id servers located in?
A: Alsofwah.or.id has servers located in the United States.
Q: What webserver software does Alsofwah.or.id use?
A: Alsofwah.or.id is powered by Apache webserver.
Q: Who hosts Alsofwah.or.id?
A: Alsofwah.or.id is hosted by WebNX, Inc. in California, Los Angeles, United States, 90017.
Q: How much is Alsofwah.or.id worth?
A: Alsofwah.or.id has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Alsofwah.or.id Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Alsofwah.or.id Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Alsofwah.or.id

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

30 :

Google Adsense

:
pub-1631667653484981

Google Analytics

:
Not Applicable

Links - Internal

815:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Alsofwah.or.id

celak mataperlengkapan kecantikanpada harishalat shubuhpenjagakirimkecantikanabdulbagi yangkeluargaada apa dengantapi tidakmemberihukum cairanshalat wajibkahapa yang harusapa hukumwanitatetapi tidakmenanggungkeluarganyasitusdalam shalathukum orang yanghanyamencicipi makanandunia islamhukum darahsahur ketikakencingcelak mata danhari sebelumbepergianimamdari wanitaandauntuktibaoktoberhukum shalatseputarislamsudahyang meninggalsahkahpendapatpilpelarimimpikirim keke temansetelah empat puluhpergi hajiyang keluar dariberdasarkanhajar aswadpuasanyabagaimanamutiarasahurdilakukanramadhan hukumkecantikan lainnya dimanifatwaitu adalahbacaanakhirmeninggalkanmenangguhkan shalatbersamadi waktuwebsiteorang yang sedangabdullahbenarmata danshallallahu alaihi wasallaminaidi siangdengan caramampubulan ramadhanmateri kitindex kirim kesetiapberpuasapriaketika adzan subuhmenelan pil pencegahparasejakgigikarena tidak tahusaihari ramadhanmembasuhinginmasjidilmalam hariterusmengeluarkan darahharus dilakukanhamilyang sedang berpuasaisyatidak mengqadhaagarhakarafahsetelah itunbspwanita tidakbeberapamateridengan menanggunganalisaallahistri di siangsaat berpuasatidak bolehthawafadzanmanasiktaksatumesirwashalatbagaimana hukumnyasurat aliapa yangmahramkehamilanpil pencegah haidterkena najistidak berpuasa karenamenjagakuning yang keluarmanasik hajilailatultidak wajibsiang hari ramadhanhaji atauthawaf wadasebagaiseorang wanitawudhupil pencegahantarasuratkeguguranpuasa danterhadapnabimelakukanberpuasa selamakepadayang palingifadhahyang lalu tidaksekarangperlengkapanoleh orang yangdi baliknamasayabuka puasamenjadirekhukum menggunakanseseorangtidak adaituterbitbulan ramadhan hukumramadhanbagi yang berpuasabinperlengkapan kecantikan lainnyagerakanyang sedangshubuhdi masjidil haramdanapa denganenam harikemaluannyaanda mendahului pelariharilupakeguguran keguguranorang lainitikafposisimerusaksedang shalatwajibterus mengeluarkanindex kirimnajislakilakijika seorangyang terussatu rukunumrahsiang harimengalamimandijawabanjika wanitasaat ihramduniateman versi cetaknbspartikelbisamengqadha puasaasharmelaluitetapiobatapakah iashalat berjamaahpada saatsyaratberpuasa hukumjunubyang meninggalkan shalatempat0isterituaamalansuatuwudhunyaadzan subuhwanita telahtujuhpernahqadhasyaikhmelaksanakankepalamasasakittidak shalatkarena sakitshiyamatau duapenentuanenamlanjutbagi wanita yangdiurutanpertamaversi cetaknbspartikelorang yang meninggalmembatalkanbagi wanitabukancairan keruhteman versikeluar lagipahalakeciliacelakketika adzanuntuk shalatrukunkajiandakwahdi bulanselengkapnyahitmenunaikan ibadah hajimencium hajartarawihdan perlengkapanmusibah danmencampuri istri dimanaperbedaan antaramudamudisalah satubesarberjamaah diuntuk orang lainkecualidua hari sebelumlainpuasa yangmenelan pilihram hukumtotalberusiapuluhshalatnyano rektidak berpuasayang haruskarena tidaknabi shallallahu alaihimendapat kesuciancairan kuninglagimemaksawasallambolehekonomithawaf ifadhahpadamerekahukum menangguhkanali imranbersetubuh didi rumahpuasacairan itusastrabersucitarikh tokohbenarkaharabseorangistrishalat subuhkhususmengakhirkan qadhayangdatangnbsp nbspjuninifas mengeluarkanmakan sahur ketikatatkalakamidarah dariyang tidakistri diwanita yang terusmengakhirkan qadha puasalebihsedang berpuasa hukumtapisajamelahirkansertaakanduamengenakansampaimengenakan pakaianmencicipidi siang hariorang yangpuasa ramadhanmeninggalkan shalat hukumpuluh harikewajibanke jeddahatau umrahdiwajibkanmakakasetulamaapakah tubuhkeruhlimaibadahinimeletakkankalimencarikuningshalat tarawihyang puasahaji dankesuciannyatentangorang yang puasamakan sahuryang berpuasamengakhirkanarab saudimenciumberjamaahdi masjidilcetaknbspartikelmenyentuh wanitamakanalsofwacairan yangberbukadan perlengkapan kecantikanataudua harizakatbukacairanimrancarakhutbahfirqahnifas mengeluarkan darahmusafirmasa nifasberhentike teman versiketika puasapuasa karenamenyempurnakanolehia berpuasashiyam puasaperempuanhaidh hukumempat puluhmenunaikan ibadahagar bisatetapia tidakdalam keadaanramadhan karenaitu keluarmenunaikan hajimenunaikanalihaidhjeddahharusputihrasulullahada apabelakangtubuh wanitaair kencingtidakfiqihhukum melontarmenggunakanwaktudi dalamapa dengan valentinespalingkaum wanitaquranwanita untukdi saatbankhamil danpertanyaanatau dua harisafarsedangbalikhajaristri setelahhajisuciramadhan berikutnyasurat ali imranaswadsedang berpuasasakinahdengantidurkeluarversibersetubuhsunnahhorangtata caramasjiddi bulan ramadhanmasa haidhsepuluhmiqatjika seorang wanitasetelah empatnotahunhukum membacarumahpuasa hukumkecantikan lainnyaminumhaditspakaianmenentukanwanita dalamhaji hukumpuasa dan shalatmenangguhkananda wajibamalan hajidari orang yangyang telahmenelanmakanantidak berpuasa selamadalamkegiatanmahram wanitamengqadha shalatpencegahyang harus dilakukanbeberapa saattidak membatalkanlalu tidakkisahurutanharammuslimkaumbagiberwudhusetelahmengeluarkan cairanmeninggalkan salah satudzikiralaihilainnya di sianglainnya diwanita nifasuntuk orangmenggauli istrimelaksanakan shalat zhuhurjika andatelahmuhammadtafsirbulanpencegah haidpenggantihewan qurbandengan valentinesberqurbanihrammelontar jumrohhinggatersebutjumrohbelummata dan perlengkapanmembatalkan puasayang lalusebelumtubuhshalat denganjikavalentinesputrijawaban andahukum meninggalkanhewannifasairnegarayang sudahwanita hamilmeninggalkan salahkepada orangkemudian setelahmencium hajar aswaddan puasaawalmeninggal denganshalat jamaahanakmempunyaikeke masjidmembacawajibkahfidyahbanyaktanganmengenaidarah yang keluarpuasa hinggasalah satu rukunbahwamendahuluisuaminyaayatprodukalquranwanita yangdan shalatmelontartidak mampuapabilamenggunakan celaklaluperbedaanbagi orang yangtataterkena3sunatkitdi belakangmandi haidhbolehkahmeneruskeluar daridan setelahmeninggalkan shalatqadha puasa hinggadoayang bukanmenyusuiilmukonsultasipadahalbilahaji dan umrahdiwanita diwanita hamil danmengeluarkanberpuasa karenasyawwaloleh orangtidak membatalkan wudhutangannyajamaahbayimendahului pelarilebih utamahukum darah yanghidangandarah yangbersetubuh di siangkemudianialahyang meninggalkancairan kuning yangwadamelaksanakan shalatmusibahampekonomi islamberpuasa tapiwajib mandikahterakhirwanita yang sedangmujizatfajarzhuhurpergi kedi masjidkarenamenggauliberitasubuhdepansuamibagi orangdi situshaji atau umrahmelakukan shalatmembatalkan wudhukeluar dari wanitaalaihi wasallammandikahsetelah berwudhumasukshalat zhuhurshalat dimatadidampingihukumbentukkesucianrukun hajiselamamendapatkanperhiasanpada bulanshalat karenaapakahke dalamanda mendahuluiimran ayatsaat ramadhankeluarnyameninggalkan shalat karenashalat hukumniatislammiddotmembaca alquranshalat jumatsebagianmengqadhamenggunakan celak mataberikutnyasiangmasihtarikhshalat di belakangdarisalahdarah nifasjumatdownloadadasenyumbelasapatanpashafpuasa bagihukum orangyang wajibsahkah shalatdiamasalahberita kegiatanrambutmenungguhukum menggunakan celaksebagian mudamudimenyentuhpergimemberi makanterus menerusmendapatkeutamaanistrinyakeduamasjidil haramqurban1haidmataharidan umrahqadha puasatahunabi shallallahumeninggal dengan menanggungtokohtidak tahukirim ke temanharuskahnamunhukum menangguhkan shalatyayasanmelaksanakan ibadah hajisaudiali imran ayatorang yang tidakusiashallallahu alaihimencampuri istrimelaksanakan ibadahyang terus mengeluarkanmeninggal padaberihramdarahhukum wudhunyahisabmerusak puasaterus mengeluarkan cairanyang keluarhukumnyajaninoperasisaatbukutigamenghadap2ramadhan yangkembaliutamabagiantemanmencampuripada bulan ramadhanmemilikidarah haidhhikmahkuning yangkeluar darah5menundamengalirdalam shalat hukumibadah hajidari orangcairan yang keluarsecaraadalahindexketikadan tidak4shallallahumandi junubsetelah suciempat puluh harimenyembelihmeninggalmalamkeadaanlainnyayang meninggal denganhaidh danresensidapatmengqadha puasa yang

Longtail Keyword Density for Alsofwah.or.id

KeywordsOccurences
kirim ke teman17
index kirim ke17
ke teman versi17
teman versi cetaknbspartikel17
di siang hari14
siang hari ramadhan13
di bulan ramadhan12
orang yang sedang11
hukum orang yang10
empat puluh hari9
bagi orang yang9
yang sedang berpuasa9
pada bulan ramadhan7
shallallahu alaihi wasallam6
bagi yang berpuasa6
yang keluar dari6
keluar dari wanita5
haji atau umrah5
shalat di belakang5
melaksanakan ibadah haji5
bulan ramadhan hukum5
tidak berpuasa karena4
cairan yang keluar4
darah yang keluar4
apa yang harus4
pil pencegah haid4
orang yang meninggal4
yang terus mengeluarkan4
wanita yang terus4
mencium hajar aswad4
menunaikan ibadah haji4
bagi wanita yang4
nabi shallallahu alaihi4
hukum darah yang4
setelah empat puluh4
salah satu rukun4
haji dan umrah4
ali imran ayat4
surat ali imran4
dalam shalat hukum3
yang harus dilakukan3
mengakhirkan qadha puasa3
menelan pil pencegah3
meninggalkan salah satu3
orang yang tidak3
bersetubuh di siang3
yang meninggalkan shalat3
dari orang yang3
hukum menangguhkan shalat3
ketika adzan subuh3
melaksanakan shalat zhuhur3
makan sahur ketika3
yang lalu tidak3
sedang berpuasa hukum3
orang yang puasa3
meninggalkan shalat karena3
oleh orang yang3
yang meninggal dengan3
meninggal dengan menanggung3
meninggalkan shalat hukum3
wanita yang sedang3
di masjidil haram3
qadha puasa hingga3
kecantikan lainnya di3
untuk orang lain3
anda mendahului pelari3
nifas mengeluarkan darah3
atau dua hari3
dua hari sebelum3
tidak membatalkan wudhu3
jika seorang wanita3
cairan kuning yang3
wanita hamil dan3
apa dengan valentines3
terus mengeluarkan cairan3
karena tidak tahu3
tidak berpuasa selama3
lainnya di siang3
ada apa dengan3
mengqadha puasa yang3
mencampuri istri di3
istri di siang3
hukum menggunakan celak3
menggunakan celak mata3
celak mata dan3
mata dan perlengkapan3
dan perlengkapan kecantikan3
perlengkapan kecantikan lainnya3
puasa dan shalat3
kuning yang keluar3
orang yang52
bulan ramadhan35
wanita yang23
ibadah haji20
yang sedang18
index kirim17
versi cetaknbspartikel17
ke teman17
teman versi17
kirim ke17
seorang wanita16
di siang16
tidak berpuasa16
mengeluarkan darah16
siang hari15
bagi wanita15
di bulan14
hari ramadhan13
yang keluar12
mengeluarkan cairan12
melaksanakan shalat11
mengqadha puasa11
hukum orang11
puluh hari10
yang tidak10
bagi orang9
meninggalkan shalat9
bagi yang9
sedang berpuasa9
wanita hamil9
empat puluh9
shalat hukum9
apa yang9
dalam shalat9
shalat di9
masa haidh9
darah yang8
kaum wanita8
qadha puasa8
yang berpuasa8
puasa ramadhan8
pada bulan8
orang lain7
di dalam7
ramadhan hukum7
haji hukum7
keluar dari7
hewan qurban7
pada hari7
hukum shalat7
melakukan shalat7
puasa yang7
mandi junub7
berpuasa selama6
shallallahu alaihi6
alaihi wasallam6
yang telah6
salah satu6
beberapa saat6
darah nifas6
di masjid6
melaksanakan ibadah6
membatalkan wudhu6
shalat jumat6
puasa dan6
haji atau6
jika seorang6
hukum menggunakan6
pil pencegah6
cairan yang5
haidh dan5
yang harus5
tidak tahu5
masa nifas5
dari wanita5
hukum darah5
di balik5
atau umrah5
enam hari5
tidak boleh5
di rumah5
terus menerus5
yang paling5
wanita dalam5
wanita untuk5
di belakang5
dalam keadaan5
yang terus5
jika wanita5
pergi haji5
menunaikan haji5
hari sebelum5
berpuasa karena5
arab saudi5
ke dalam4
pencegah haid4
tidak membatalkan4
setelah empat4
dan setelah4
kemudian setelah4
atau dua4
tidak mampu4
haji dan4
mencampuri istri4
terus mengeluarkan4
mata dan4
cairan keruh4
cairan itu4
bagaimana hukumnya4
jika anda4
mendahului pelari4
dan tidak4
dan umrah4
wanita nifas4
ia berpuasa4
shiyam puasa4
thawaf wada4
berpuasa hukum4
ihram hukum4
membaca al-quran4
hukum membaca4
untuk orang4
satu rukun4
imran ayat4
hukum meninggalkan4
mencium hajar4
malam hari4
hajar aswad4
shalat berjamaah4
untuk shalat4
setelah suci4
di waktu4
adzan subuh4
thawaf ifadhah4
shalat zhuhur4
hamil dan4
yang meninggal4
ramadhan karena4
no rek4
nabi shallallahu4
menunaikan ibadah4
rukun haji4
berita kegiatan4
surat ali4
apa hukum4
wanita di4
ali imran4
anda wajib4
melontar jumroh4
saat ihram3
saat berpuasa3
puasa karena3
dengan cara3
lainnya di3
kecantikan lainnya3
darah dari3
perlengkapan kecantikan3
dan perlengkapan3
menggauli istri3
celak mata3
hukum melontar3
ke jeddah3
istri di3
menggunakan celak3
bersetubuh di3
membatalkan puasa3
ketika puasa3
menelan pil3
dari orang3
merusak puasa3
yang wajib3
tidak wajib3
ramadhan berikutnya3
mengakhirkan qadha3
mencicipi makanan3
tidak shalat3
puasa hukum3
meninggal pada3
makan sahur3
mahram wanita3
sahur ketika3
ketika adzan3
harus dilakukan3
tapi tidak3
yang puasa3
oleh orang3
puasa hingga3
meninggal dengan3
ramadhan yang3
lalu tidak3
dengan menanggung3
puasa bagi3
yang lalu3
tarikh tokoh3
tidak mengqadha3
kepada orang3
yang meninggalkan3
meninggalkan salah3
shalat dengan3
mengenakan pakaian3
pergi ke3
agar bisa3
sahkah shalat3
tetapi tidak3
menangguhkan shalat3
tata cara3
ada apa3
apa dengan3
dengan valentines3
tidak ada3
nbsp nbsp3
di situs3
shalat subuh3
hukum menangguhkan3
musibah dan3
shalat jamaah3
materi kit3
ekonomi islam3
buka puasa3
ke masjid3
lebih utama3
di masjidil3
masjidil haram3
di saat3
berjamaah di3
sedang shalat3
shalat shubuh3
shalat karena3
karena sakit3
apakah ia3
shalat wajibkah3
mengqadha shalat3
shalat tarawih3
memberi makan3
sebagian muda-mudi3
dan puasa3
hukum cairan3
tubuh wanita3
setelah itu3
wanita telah3
yang sudah3
yang bukan3
darah haidh3
perbedaan antara3
cairan kuning3
keluar lagi3
kuning yang3
setelah berwudhu3
itu keluar3
karena tidak3
pada saat3
jawaban anda3
anda mendahului3
itu adalah3
istri setelah3
dua hari3
saat ramadhan3
hukum wudhunya3
berpuasa tapi3
manasik haji3
wanita tidak3
mendapat kesucian3
terkena najis3
air kencing3
menyentuh wanita3
mandi haidh3
nifas mengeluarkan3
wajib mandikah3
apakah tubuh3
dunia islam3
keluar darah3
ia tidak3
haidh hukum3
keguguran keguguran3
dan shalat3
amalan haji3
yang214
dan121
wanita120
hukum118
shalat113
di105
tidak89
puasa89
ramadhan78
orang72
haji68
hari64
berpuasa59
dalam53
dengan47
setelah45
bagi45
bulan44
pada44
dari43
darah43
untuk41
apakah40
ke38
atau36
haidh34
karena34
saat33
mengeluarkan33
sebelum32
seorang30
jika28
cairan28
itu28
ia27
keluar26
ketika26
nifas25
anda25
ibadah24
sedang24
wajib24
melaksanakan22
adalah21
thawaf21
ihram20
mengqadha20
index19
mandi19
dua18
apa18
telah18
siang18
versi17
masa17
selengkapnyahit17
kirim17
cetaknbspartikel17
teman17
melakukan16
kemudian16
masjid16
umrah16
beberapa15
kepada15
tanpa15
islam15
selama14
tahun14
puluh14
meninggalkan14
menggunakan14
imam14
satu13
ada13
membatalkan13
kaum13
bolehkah13
harus13
haid13
hamil12
junub12
al-quran12
tapi12
jumat12
berwudhu12
cara12
ini11
terus11
hikmah11
waktu11
lalu11
subuh11
wudhu11
bin11
keguguran11
istri11
empat11
suci11
air11
qadha10
salah10
lain10
maka10
rambut10
menunaikan10
meninggal10
tentang10
bagaimana10
makan10
najis10
hingga10
datang10
bersama10
boleh10
lagi9
para9
adzan9
ilmu9
nbsp9
membaca9
doa9
hewan9
bahwa9
kewajiban9
hadits9
qurban9
terhadap8
melahirkan8
tiga8
hukumnya8
pakaian8
alaihi8
akhir8
fatwa8
jamaah8
berihram8
berjamaah8
kegiatan8
oleh8
allah8
pergi8
belum8
matahari8
rumah8
dapat7
niat7
sebagai7
rukun7
malam7
awal7
zakat7
kepala7
al-sofwa7
berita7
shallallahu7
menyembelih7
perbedaan7
bisa7
pertama7
lebih7
saya7
fajar7
dilakukan7
pencegah7
nabi7
mendapat7
mencium7
sebagian6
manasik6
melontar6
enam6
anak6
menyusui6
menyentuh6
tubuh6
sai6
bersetubuh6
mereka6
kedua6
antara6
jawaban6
suatu6
jeddah6
surat6
hanya6
belakang6
mata6
miqat6
setiap6
mahram6
mampu6
lima6
minum6
pil6
wasallam6
shiyam6
sejak6
paling6
sakit6
fiqih6
suami6
menerus5
shalatnya5
kencing5
pertanyaan5
mengenakan5
lainnya5
berqurban5
balik5
suaminya5
keadaan5
bila5
oktober5
rasulullah5
khusus5
tidur5
mencampuri5
shaf5
syawwal5
kami5
syaikh5
istrinya5
nama5
05
bank5
abdul5
sudah5
seputar5
isteri5
obat5
ingin5
kajian5
menjadi5
tahu5
kecil5
ayat5
terbit5
shubuh5
wajibkah5
amalan5
mutiara5
tersebut5
pelari5
masuk5
tarikh5
musafir5
tafsir5
keluarnya5
kuning5
arab5
saudi5
muhammad5
bentuk4
mendahului4
sahur4
mengalami4
janin4
belas4
keruh4
mimpi4
kembali4
menggauli4
imran4
ali4
merusak4
pahala4
jumroh4
tua4
ifadhah4
mempunyai4
namun4
perempuan4
aswad4
mani4
perhiasan4
hajar4
melalui4
kecuali4
wada4
terakhir4
sekarang4
puasanya4
bukan4
pendapat4
arafah4
konsultasi4
akan4
masalah4
mendapatkan4
tetap4
keutamaan4
lupa4
tetapi4
dzikir4
mengenai4
apabila4
mengakhirkan4
sunnah4
sampai4
dakwah4
buku4
situs4
menghadap4
musibah4
rek4
mesir4
khutbah4
mujizat4
quran4
sastra4
resensi4
dunia4
yayasan4
terkena4
buka4
abdullah4
haruskah4
utama4
pria4
wa4
zhuhur4
no4
syarat4
usia4
mencari4
14
tiba4
tangannya4
24
berbuka4
amp4
banyak4
34
pernah4
berdasarkan3
memiliki3
itikaf3
produk3
negara3
43
keluarga3
menelan3
gigi3
bayi3
hidangan3
islammiddot3
berikutnya3
makanan3
mencicipi3
sepuluh3
keluarganya3
putri3
bepergian3
masjidil3
haram3
seseorang3
kecantikan3
safar3
lailatul3
menanggung3
laki-laki3
tak3
kisah3
menyempurnakan3
tangan3
meletakkan3
serta3
besar3
sakinah3
tokoh3
tatkala3
kaset3
didampingi3
penentuan3
materi3
kit3
firqah3
ekonomi3
analisa3
senyum3
fidyah3
download3
menjaga3
ialah3
menentukan3
hisab3
perlengkapan3
memaksa3
celak3
juni3
menunggu3
agar3
sahkah3
sunat3
tata3
mana3
kemaluannya3
memberi3
berhenti3
mengalir3
valentines3
operasi3
posisi3
h3
menunda3
website3
benar3
bersuci3
mandikah3
kali3
ulama3
total3
53
membasuh3
inai3
kehamilan3
hak3
masih3
putih3
saja3
depan3
wudhunya3
tujuh3
benarkah3
pengganti3
bagian3
berusia3
diwajibkan3
isya3
diurutan3
padahal3
menangguhkan3
dia3
muda-mudi3
bacaan3
secara3
ashar3
muslim3
kesuciannya3
kesucian3
lanjut3
tarawih3
penjaga3
gerakan3
urutan3

Who hosts Alsofwah.or.id?

Alsofwah.or.id Hosting Provider Information

Hosted IP Address:104.237.50.195
Hosted Hostname:castor-4.idgx.net
Service Provider:WebNX, Inc.
Hosted Country:United StatesUS
Location Latitude:34.0584
Location Longitude:-118.278
Webserver Software:Apache

Is "WebNX, Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
38.7768%
GoDaddy.com, LLC
20.0663%
Namecheap, Inc.
9.8730%
Confluence Networks Inc
6.3707%
Google Inc.
6.0392%
Merit Network Inc.
4.3939%
Amazon.com, Inc.
4.2919%
1&1 Internet AG
4.2685%
Fara Negar Pardaz Khuzestan
3.8053%
Cogent Communications
3.5576%
WebNX, Inc.
0.0247%

HTTP Header Analysis for Alsofwah.or.id

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 03 Nov 2020 17:04:40 GMT
Server: Apache
X-Powered-By: PHP/5.3.29
Upgrade: h2
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=cp1256

Alsofwah.or.id Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts Alsofwah.or.id?


Domain Registration (WhoIs) information for Alsofwah.or.id

Websites with Similar Names

Alsof.ltd
Сайт alsof.ltd не настроен на сервере
Alsofair.com
Hosted By One.com | Webhosting made simple
Alsofashion.com
ALSO Fashion - En construction / Under construction
Alsofell.xyz
404 Not Found
Alsofhampden.com
HOME | ALS OF HAMPDEN · ENOLA, PA · PIZZA. BEER. HAPPY.
Alsofi.net
AWordPressSite – Just another WordPress site
Alsofia.com
Al Sofia Music | Chicago Wedding Band, Corporate Event Band, Fundraiser Gala Band
Alsofica.com
Alsofica Company
Alsofigroup.com
Ahmed Alsoufi Trading & Contracting Est.
Alsofitit.com
Alsofitit

Recently Updated Websites

Coinmarketcalendar.com (3 seconds ago.)Bgsrp.com (5 seconds ago.)Mu-sly.co.uk (6 seconds ago.)Sharpsandmedicalwastedisposal.com (6 seconds ago.)Maisonlaprise.net (7 seconds ago.)Obsidinvestpartners.com (8 seconds ago.)Fresheggs.today (8 seconds ago.)Konettmarine.com (19 seconds ago.)Mcfarlandchevybuick.com (22 seconds ago.)Afrolend.com (26 seconds ago.)Caretopray.net (26 seconds ago.)Extendchain.com (29 seconds ago.)Cozyframe.com (32 seconds ago.)Bulasale.com (33 seconds ago.)Hjc763.com (34 seconds ago.)Sunroomsseattle.com (35 seconds ago.)Gustavoemarinacouto.com (36 seconds ago.)Alicekuliplive.com (42 seconds ago.)Getiopolis.com (46 seconds ago.)Thelaste.org (46 seconds ago.)Love678.net (48 seconds ago.)Mordernemum.com (50 seconds ago.)Yaani.space (52 seconds ago.)Kinohoytee.site (53 seconds ago.)Global-recharge.com (54 seconds ago.)Hopssauce.com (55 seconds ago.)Nnaligarh.in (57 seconds ago.)Milwaukeehealthcarepartnership.org (59 seconds ago.)Etherra.com (59 seconds ago.)Soupycup.com (1 minute 1 second ago.)

Recently Searched Keywords

extreme weather (4 seconds ago.)mint music (6 seconds ago.)ffffff slideshow-1540952363851 (9 seconds ago.)2990 nbsp nbsp (11 seconds ago.)cyan (12 seconds ago.)crown lengthening (17 seconds ago.)ca lng v (18 seconds ago.)qashqirlar makoni 43 44 qism ok.ru (19 seconds ago.)castilla y (19 seconds ago.)memotret (20 seconds ago.)bagageband engels (23 seconds ago.)switch wordpress themes (23 seconds ago.)iphone repair services (24 seconds ago.)besitza (27 seconds ago.)mergers (29 seconds ago.)nov 11 (31 seconds ago.)0px 0px 0pxbox-shadow (32 seconds ago.)bridge base online help (33 seconds ago.)alternatif bet365 (36 seconds ago.)cucina a l (37 seconds ago.)rent a bike (38 seconds ago.)oa系统 (38 seconds ago.)322px 05 (39 seconds ago.)nagorno karabagh (46 seconds ago.)nouveaux produits (46 seconds ago.)namecheap login (49 seconds ago.)hosting claris (52 seconds ago.)filemaker salg (53 seconds ago.)important-webkit-flex-directioncolumn (55 seconds ago.)creek (55 seconds ago.)