AlternativeNation.net

Safety: Low trust score
Year Founded: 2011
Global Traffic Rank: 103,969
Estimated Worth: $124,800



Domain summary

Last updated
2021-03-27
Domain label
alternativenation
Domain extension
net
Domain registered:
2011-06-09
Domain updated:
2020-02-26
Global Traffic Rank
103,969
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$124,800
Estimated daily income
$208
Estimated monthly income
$6,327

Rank summary

How is alternativenation.net ranked relative to other sites:

Percentage of visits to alternativenation.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Alternativenation.net registered?
A: Alternativenation.net was registered 9 years, 10 months, 3 days, 20 hours, 6 minutes, 57 seconds ago on Thursday, June 9, 2011.
Q: When was the WHOIS for Alternativenation.net last updated?
A: The WHOIS entry was last updated 1 year, 1 month, 2 weeks, 1 day, 20 hours, 6 minutes, 57 seconds ago on Wednesday, February 26, 2020.
Q: What are Alternativenation.net's nameservers?
A: DNS for Alternativenation.net is provided by the following nameservers:
  • ns41.domaincontrol.com
  • ns42.domaincontrol.com
Q: Who is the registrar for the Alternativenation.net domain?
A: The domain has been registered at GODADDY.COM, LLC.
Q: What is the traffic rank for Alternativenation.net?
A: Alternativenation.net ranks 103,969 globally on Alexa. Alternativenation.net has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Alternativenation.net each day?
A: Alternativenation.net receives approximately 16,638 visitors and 83,190 page impressions per day.
Q: What IP address does Alternativenation.net resolve to?
A: Alternativenation.net resolves to the IPv4 address 192.124.249.162.
Q: In what country are Alternativenation.net servers located in?
A: Alternativenation.net has servers located in the United States.
Q: What webserver software does Alternativenation.net use?
A: Alternativenation.net is powered by Sucuri/Cloudproxy webserver.
Q: Who hosts Alternativenation.net?
A: Alternativenation.net is hosted by Sucuri in United States.
Q: How much is Alternativenation.net worth?
A: Alternativenation.net has an estimated worth of $124,800. An average daily income of approximately $208, which is roughly $6,327 per month.

Alternativenation.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Alternativenation.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Alternativenation.net

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

43 :
  1. Stone Temple Pilots Releasing New ‘Tiny Music’ Song
  2. Pearl Jam Rumored To Play Huge Seattle Concerts
  3. Metallica Reveal Sad Jason Newsted Tour Secret
  4. Foo Fighters React To ‘Not Playing’ On Major Album
  5. Stone Temple Pilots Releasing New ‘Tiny Music’ Song
  6. Pearl Jam Rumored To Play Huge Seattle Concerts
  7. Metallica Reveal Sad Jason Newsted Tour Secret
  8. Blake Red Premieres Masterpiece “Follow Me” Video
  9. Foo Fighters React To ‘Not Playing’ On Major Album
  10. Stone Temple Pilots Reveal Unheard 1996 Recording
  11. Soundgarden Defeat Vicky Cornell In Major Legal Battle
  12. Jane’s Addiction Reunite For New 2021 Movie
  13. Stone Temple Pilots Celebrate ‘Tiny Music’ 25th Anniversary
  14. Jason Newsted ‘Didn’t Want To’ Leave Metallica?
  15. Smashing Pumpkins ‘Adore’ Real Title Finally Revealed
  16. Imagine Dragons Are The Worst Band Ever
  17. ZZ Top Reveal Bold Truth About Greta Van Fleet
  18. Review: Shannon Hoon Lives On In ‘All I Can Say’ Film
  19. Top 15 Metal Albums of 2018
  20. Top 10 Rock Songs Of 2018: Pearl Jam, Chris Cornell &...
  21. Top 10 Iconic Guitar Solos Of The 90’s
  22. Top 15 Greatest Freddie Mercury Performances
  23. Top 10 Creepiest Alternative Rock Halloween Songs
  24. Top 10 Alternative Rock Drummers Of The 90’s
  25. Ace Frehley Reveals If KISS’ Paul Stanley Is Lip Syncing
  26. Ozzy Osbourne Unloads On Threat To Child In Video
  27. Clutch Drummer Talks Upcoming Album And Current Tour
  28. Scott Weiland & Nirvana Unseen Interviews Finally Revealed
  29. Green Day Ridiculous Metallica Demand After Rehab Leaks
  30. James Hetfield Unloads On Canceling Metallica Tour For Rehab
  31. Metallica Bassist Reveals Painful Ozzy Osbourne Photo
  32. Ozzy Osbourne Son Reacts To Sad ‘Death Bed’ Photo
  33. James Hetfield ‘Collapses’ Backstage In New Metallica Photo
  34. Stone Temple Pilots Releasing New ‘Tiny Music’ Song
  35. Pearl Jam Rumored To Play Huge Seattle Concerts
  36. Metallica Reveal Sad Jason Newsted Tour Secret
  37. Blake Red Premieres Masterpiece “Follow Me” Video
  38. Foo Fighters React To ‘Not Playing’ On Major Album
  39. Stone Temple Pilots Reveal Unheard 1996 Recording
  40. Soundgarden Defeat Vicky Cornell In Major Legal Battle
  41. Jane’s Addiction Reunite For New 2021 Movie
  42. Stone Temple Pilots Celebrate ‘Tiny Music’ 25th Anniversary
  43. Jason Newsted ‘Didn’t Want To’ Leave Metallica?

H4 Headings

6 :
  1. Rock Features
  2. Deep Cuts
  3. Lists
  4. Interviews
  5. Metal
  6. LATEST ARTICLES

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

74 :

Google Adsense

:
pub-5296172734705889

Google Analytics

:
UA-42350231-1

Links - Internal

117:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Alternativenation.net

davetdsubcatmorejason newsted tourconcertscenter backgroundsize 18pxboldtextdecorationposition relative20px marginleft 2pxlinearmargin 0px 0pxborderwidth 1pxbeforebackground urlhttpwwwalternativenationnetwpcontentpluginswdfacebookfeedimagesfeedtimegraypng norepeatfunction spiderpage0thissad jasontemple pilots releasingpositionffwdcontainer10 ffwdcontainer20 blogstyleobjectsconteiner0photo janffwdsharebutton0ffwdcommentcontent0 ffwdcommentreplies014px fontfamily inheritcenter centerjason0px 0px 0pxhaha wowshopblogstyleobjectcontainer0 ffwdcomment0 ffwdcommentreply0ffwdviewmorecommentscont0left display4px 0px 0pximportantimportant ffwdcontainer10 ffwdcontainer205view on facebookplaying8217pointer ffwdcontainer10 ffwdcontainer20relative ffwdcontainer10 ffwdcontainer20bandmasterpiecedocumentgetelementbyidpagenumber0valuehaveinherit ffwdcontainer10 ffwdcontainer2014pxred premieres masterpiecetdpostcategoryhover backgroundcolorx 114px floatmajor legaltdmodulewraphover entrytitlebold color 666666zindexffwdcontainer20 ffwdblogstyleobjectinfocontainer0epreventdefaulturlhttpwwwalternativenationnetwpcontentpluginswdfacebookfeedimagesfeedlikegraypng norepeat 3pxblakewindowadsbygooglesoundgardenrgb165 1650px textalign0px 0px 5pxbackgroundcolor 1e73beinitial color rgb165norepeat 3px centernormal fontfamily inherit03sborderstyle nonetdnextprevwrappaul mccartney deathtdloadmorewrapalternativefontsize 13px fontweightffwdcommentreplycontent0blocktitleoutline14px fontweight normalwidth25th anniversaryffwdlikesnames0urlhttpwwwalternativenationnetwpcontentpluginswdfacebookfeedimagesfeedtimegraypng1px bordercolor25 2021addictionblock height 22pxunheard 1996righttextalign left ffwdcontainer10allmarginleft16px widthoutrgb165 165 165textdecoration underlinesong brettverticalalignleft display blockdisplayinherit fontvariantpilotsborderstyle none outlineverticalalign middlesad jason newstedmaxwidthdd3333656565 fontfamilymiddlepadding 0pxfloatwow sad angry12px fontfamily4db2ec12me8221reveal sad jasonpush3px centerdocumentgetelementbyidpagenumber0value 1fontvariantmorenone ffwdcontainer10 ffwdcontainer20backgroundcolor 000000normal fontsize 14pxpush if tdscreenwidth10vickyfunctioneffwdreacts0push adsbygoogleblogstyleobjectcontainer0 ffwdcomment0 ffwdcommentreplycontent014px ffwdcontainer10spiderpage0this 1agonone borderstylefoo fighters reactcenter backgroundsize 12pximportant widthbackgroundsize 12pxnone outlinetdweatherweekbefore2pxmetallica revealrgb165ffwdcontainer10 ffwdcontainer20 ffwdshare0textdecoration noneadsbygoogle windowadsbygoogle pushfontfamily inherit colorfoo000000 fontweightahovermetallica reveal sadfontsize 14px float20px lineheight 20pxtourborderbox ffwdcontainer10 ffwdcontainer20textdecoration underline outline1 yearcursor pointer26 2021 0color rgb165music8217fighters reactanniversaryopacitynone borderstyle nonemargin 4px 0pxopacity 1blocktitle bordercolorbackgroundsize 10px fontweightphotoif tdscreenwidth1 year agoreleasing new 8216tinyheight 22px background10px 0px4db2ec tduid3605e781e7df6erandffwdcommentscontent0 ffwdviewmorecommentscont0ffwdcommentcontent0ffwdcommentscontent0entrytitleffwdcontainer20 blogstyleobjectcontainer0 ffwdcommentscontent0sad angrybackgroundcolor eaeaea13pxsolid14px ffwdcontainer10 ffwdcontainer2016display block height0px paddingblogstyleobjectsconteiner0 ffwdblogstyleheadercontainer0blogstyleobjectcontainer0 ffwdlikesnamescount0 ffwdlikesnames0wantwow02stdweatherweekbefore backgroundcolorbackgroundcolorffwdcomment0bordertopstyle solid000000 fontfamily000000 fontsize 14px10px fontweight normal8216not playing8217buchanan mar 25165 ffwdcontainer10 ffwdcontainer20ifreadtinyfontweight boldunderlineffwdcomment0 ffwdcommentreply0 ffwdcommentreplycontent0atdpulldownfilterlinkhoverbuchanan mar 26facebooknone important25 2021 0vicky cornell0sinterviews165 165 ffwdcontainer10celebratefloat left displaypremieres masterpiecefontweight normal000000ffwdblogstyleobjectinfocontainer0none ffwdcontainer1014px fontweightfoo fightersnorepeat center11ffwdblogstyleobjectveral0ahover backgroundcolorbreaktdscreenwidthtextalign leftoutline none borderstyletdblockinherit fontweightmusicsongsgrohlarrsplitsimccartney death rumor18pxangryred premieres4ffwdlikesnamescount0ffwdcomment0 ffwdcommentreplycontent0brett13px fontweightcolor 65656500px 0px textaligntemplerevealed4px3like loveinitialffwdcontainer10 ffwdcontainer20 ffwdblogstyleobjectinfocontainer03px0px textdecoration nonefloat right165 ffwdcontainer10float left ffwdcontainer10albumreturn false2backgroundcolor ffffffpilots releasingffwdcontainer10 ffwdcontainer20 tablenavpages0left ffwdcontainer10love4px 0px0px 0px 24pxfontsizeffwdcontainer20 ffwdblogstyleobjectveral0tdloadmorewrap ahoverffwdcontainer10 ffwdcontainer20 blogstyleobjectcontainer0altnationnetbordercolorabsolutepadding 0px 0pxpadding20px lineheightboxsizing borderboxffwdlikesnames0 ffwdlikenamecont02px ffwdcontainer10 ffwdcontainer20vatican gift shoptdsubcatitem tdcursimpleitemtdsubcatitem ahoverblogstyleobjectcontainer0 ffwdcomment0 ffwdcommentcontent0function0px 24pxplaying8217 on majorfeaturenorepeat 3pxplay huge seattletopcursor pointer ffwdcontainer10deathpremieres masterpiece 8220followtdreadmoredisplay blocktextalign10pxposition relative ffwdcontainer102021 0 stone24 2021legal0px textdecoration0 stonenormal fontsizefontfamilyunderline outlinepointer ffwdcontainer10revealjquerybodyonclicknew 8216tiny music821710px fontweightboxsizing borderbox ffwdcontainer10dd3333 tduid7605e781e83beerandffwdcontainer20 blogstyleobjectcontainer0 ffwdlikesnamescount0releasing new2px ffwdcontainer10mar 24fontsize 14px fontfamilyffwdlikesnamescount0 ffwdlikesnames0 ffwdlikenamecont0fontsize 14px fontweightnormal fontfamilytdtrendingnowtitletour secretinlineblockbackground urlhttpwwwalternativenationnetwpcontentpluginswdfacebookfeedimagesfeedlikegraypngjamlineheightnewffwdcomment0 ffwdcommentreply03px center backgroundsizecolor rgb165 165react0 stone templeozzyfilterffwdcommentreplies0width 20px marginleft8220followtextalign justifyleftfilter alphaopacity70all 03scolor 000000 fontfamilymarginleft 2px ffwdcontainer10ffwdblogstyleheadercontainer0hahanewsted tour secret16px width 20pxalphaopacity70solid borderwidth 1pxreturnfontvariant initialplay huge20px marginlefttransparentpearl jam rumoredyear agotransformnone color 000000mar 26 2021eddiebordertopstyle0px padding 0pxinherit ffwdcontainer10underline outline noneffwdcontainer20 ffwdshare00px ffwdcontainer10ffwdtitlespun10blocktitle spanseattleffwdlikesnamescount0 ffwdlikesnames0push ifffwdlikenamecont0metallicanew 8216tinyboxsizingtduid7605e781e83beerand blocktitleheardmargin 10px 0pxborderwidth26 20211e73be tduid5605e781e8140crandmazzaronemajorunheardfontsize 14px ffwdcontainer10100 height8216noturlhttpwwwalternativenationnetwpcontentpluginswdfacebookfeedimagesfeedtimegraypng norepeattdloadmorewrap ahover backgroundcolorwindowadsbygoogle push if12px22px backgroundffwdcontainer20 blogstyleobjectcontainer0falseurlhttpwwwalternativenationnetwpcontentpluginswdfacebookfeedimagesfeedlikegraypnggift shopblogstyleobjectcontainer0 ffwdcommentscontent0hetduid3605e781e7df6erandxtdquoteonblocks colorchrisstone temple pilotsfacebook 1 yeartduid5605e781e8140crandtduid7605e781e83beerandfontsize 12pxjan20pxwow sad0px 4pxminheightinitial colorheight 10030pxffwdcontainer10bordertopstyle solid borderwidth13paulnone colorcolor 656565 fontfamilylove hahaneverpearl jamjustifywidth 20pxblake red premieres324pxtdsubcatdropdownhover tdsubcatmore9borderstyle none colorhaha wow sadnorepeat center centerpointermike mazzaronefontfamily inherit fontsizeimportant ffwdcontainer108216tiny24pxurlhttpwwwalternativenationnetwpcontentpluginswdfacebookfeedimagesfeedlikegraypng norepeatcenter backgroundsize 16pxhuge seattletransition000000 fontfamily inherit0 0react to 8216notarrlength8216tiny music82173px 0pxtduid3605e781e7df6erand blocktitleinherit fontweight boldmarhuge8ffwdcommentreply0song brett buchananjquerythishtmlseetdweatherinformationbeforerelativewidth 324pxinheritdocumentwrite adsbygoogle windowadsbygooglebackgroundsize 18pxboxshadowadsbygoogle windowadsbygooglecolor 000000 fontweightbackgroundcolor dd3333tweets by altnationnetfontfamily inherit fontweightfloat none1 breakhuge seattle concertsitemscounty0lineheight 20pxheight8220follow me8221 video22pxbackground urlhttpwwwalternativenationnetwpcontentpluginswdfacebookfeedimagesfeedtimegraypngnews like lovefontstyle normalnews likelikeffwdcontainer20rockfontsize 12px fontfamily14px float left12px fontfamily inherittweetsmccartneyposition absolutereveal saddocumentwritecenterfunctione epreventdefault0px 5pxbrett buchanan marjason newstedredbreak caserumorfontsize 14pxcenter center backgroundsizeffwdcontainer20 blogstyleobjectcontainer0 ffwdcomment0blogstyleobjectcontainer0rumoredborderradius17pxdeath rumorbrett buchananjquerythisparentfindmoredotescssdisplaywidth 100cursortemple pilotsblogstyleobjectcontainer0 ffwdcomment014ffwdcontainer10 ffwdcontainer20 ffwdblogstyleobjectveral0backgroundtransition allbackgroundcolor 4db2ec20px padding 0pxfontweightinherit fontvariant initialleft ffwdcontainer10 ffwdcontainer20fontweight normal fontsizevatican giftborderstylemccartney deathfontsize 13pxffwdcomment0 ffwdcommentcontent0 ffwdcommentreplies0tdsubcatdropdownhover000000 fontsizeblogstyleobjectcontainer0 ffwdlikesnamescount0margin 10px0px 0pxmargin 0px1pxme8221 video656565 fontfamily inheritdisplay noneclassicoutline none ffwdcontainer101color 656565 outlinetdpostcategoryhovermar 26cutsmar 24 2021secretrelative ffwdcontainer10ffwdcontainer10 ffwdcontainer20premieres656565 outlineffwdcontainer20 blogstyleobjectsconteiner0 ffwdblogstyleheadercontainer0newsted0pxfontweight bold colorhadbuchanan marbackgroundsize 16pxdave grohl20px paddingvaticanborderboxblogstyleobjectcontainer0 ffwdcommentscontent0 ffwdviewmorecommentscont0noneseattle concertstdcursimpleitemblock16pxloadmorebackgroundsize 16px widthzindex 1facebook 1music8217 songmajor albummarginleft 2pxfontstylefloat leftmusic8217 song brettjam rumoredtdnextprevwrap ahoverimgozzy osbourneminheight 20pxcolor 666666ffwdshare0push adsbygoogle windowadsbygooglepadding 3pxmikedocumentwrite adsbygooglenewsinlinebackgroundsizeview8220follow me82217165 165margin 4pxnormalblake redmar 25 2021fontweight normal fontfamilynewsted tourtextalign centerosbourneplayheight 22px15yborderstyle none ffwdcontainer10fontfamily inherit ffwdcontainer10656565 outline nonegiftcolor 000000 fontsizeadsbygooglespanfighterssolid borderwidthautorumored to playbackground urlhttpwwwalternativenationnetwpcontentpluginswdfacebookfeedimagesfeedlikegraypng norepeatdeepbackgroundsize 10px000000 fontweight normalmargin0px ffwdcontainer10 ffwdcontainer20blogstyleobjectsconteiner0width 100 heightoutline nonemaxwidth 100fontvariant initial colorlike love hahatdquoteonblocksffwdcontainer20 blogstyleobjectsconteiner0pearlffwdcomment0 ffwdcommentcontent0top 10center backgroundsize 10pxscale12casesadwindowadsbygoogle push6visibilitylineheight 20px paddingfunction spiderpage0this 1couldbuchananpaul mccartney0px textalign leftdeep cutstablenavpages08216tiny music8217 songpilots releasing newcolorborderwidth 1px bordercolormar 25leavelove haha woweaeaeamasterpiece 8220follow me8221color 000000windowadsbygoogle push adsbygoogleyeartiny musicsongsinherit fontsize5pxtdmodulewraphovertextdecoration none outlinenew tdblockvarcornellspiderpage0thisconcertinherit colorstonestone temple2019 1elseffwdtooltip0songmay2021 0display inlineblockfontfamily inherit fontvariantcenter backgroundsizeblock heightinherit fontweight normalborderbox ffwdcontainer10tduid5605e781e8140crand blocktitle25thfontfamily inherit1e73bevideoffwdcommentreply0 ffwdcommentreplycontent0angry viewreleasingtdsubcatitempadding 3px 0px6pxffffffffwdcontainer20 tablenavpages014px fontfamilybold colorsad angry viewread morenorepeatnone outline nonemasterpiece 8220followminheight 20px lineheight

Longtail Keyword Density for Alternativenation.net

KeywordsOccurences
ffwdcontainer10 ffwdcontainer20 blogstyleobjectcontainer042
0px 0px 0px21
ffwdcontainer10 ffwdcontainer20 ffwdblogstyleobjectinfocontainer019
ffwdcontainer20 blogstyleobjectcontainer0 ffwdcomment018
font-weight normal font-size17
normal font-size 14px17
none border-style none17
outline none border-style17
font-family inherit font-weight15
none ffwdcontainer10 ffwdcontainer2015
ffwdcontainer20 blogstyleobjectcontainer0 ffwdlikesnamescount013
brett buchanan mar13
stone temple pilots12
3px center background-size12
no-repeat 3px center12
inherit font-weight normal11
adsbygoogle windowadsbygoogle push10
normal font-family inherit10
blogstyleobjectcontainer0 ffwdcomment0 ffwdcommentcontent09
mar 26 20219
0px ffwdcontainer10 ffwdcontainer209
margin 0px 0px8
center center background-size8
font-weight normal font-family8
no-repeat center center8
mar 25 20218
none outline none8
buchanan mar 267
padding 0px 0px7
display block height7
4px 0px 0px6
blogstyleobjectcontainer0 ffwdlikesnamescount0 ffwdlikesnames06
color 000000 font-family6
ffwdcontainer10 ffwdcontainer20 ffwdblogstyleobjectveral06
26 2021 06
ffwdcontainer20 blogstyleobjectcontainer0 ffwdcommentscontent06
left ffwdcontainer10 ffwdcontainer206
000000 font-family inherit6
border-style none ffwdcontainer106
float left display6
left display block6
color 000000 font-size6
block height 22px6
outline none ffwdcontainer106
height 22px background6
width 20px margin-left5
14px font-weight normal5
border-style none color5
inherit ffwdcontainer10 ffwdcontainer205
ffwdcontainer10 ffwdcontainer20 tablenav-pages05
font-family inherit ffwdcontainer105
font-size 14px font-weight5
text-decoration none outline5
color 000000 font-weight5
function spiderpage0this 15
20px margin-left -2px5
ffwdcontainer10 ffwdcontainer20 blogstyleobjectsconteiner05
-2px ffwdcontainer10 ffwdcontainer205
margin-left -2px ffwdcontainer105
font-size 14px font-family5
14px font-family inherit5
like love haha4
haha wow sad4
656565 font-family inherit4
color 656565 font-family4
view on facebook4
sad angry view4
font-size 13px font-weight4
ffwdlikesnamescount0 ffwdlikesnames0 ffwdlikenamecont04
font-family inherit color4
wow sad angry4
blogstyleobjectcontainer0 ffwdcomment0 ffwdcommentreplycontent04
14px ffwdcontainer10 ffwdcontainer204
font-size 14px ffwdcontainer104
0px text-align left4
love haha wow4
blogstyleobjectcontainer0 ffwdcomment0 ffwdcommentreply04
ffwdcontainer10 ffwdcontainer20 ffwdshare04
center background-size 18px4
center background-size 16px4
none color 0000004
1 year ago4
blogstyleobjectcontainer0 ffwdcommentscontent0 ffwdviewmorecommentscont04
documentwrite adsbygoogle windowadsbygoogle4
vatican gift shop4
windowadsbygoogle push adsbygoogle4
position relative ffwdcontainer104
25 2021 04
buchanan mar 254
play huge seattle4
huge seattle concerts4
push adsbygoogle windowadsbygoogle4
metallica reveal sad4
reveal sad jason4
mar 24 20214
rumored to play4
sad jason newsted4
jason newsted tour4
newsted tour secret4
foo fighters react4
react to 8216not4
playing8217 on major4
2021 0 stone4
0 stone temple4
relative ffwdcontainer10 ffwdcontainer204
pearl jam rumored4
margin 10px 0px4
new 8216tiny music82174
border-width 1px border-color4
solid border-width 1px4
temple pilots releasing4
pilots releasing new4
font-weight bold color4
releasing new 8216tiny4
inherit font-weight bold4
font-size 12px font-family4
12px font-family inherit4
8216tiny music8217 song4
paul mccartney death3
windowadsbygoogle push if3
news like love3
20px padding 0px3
td-load-more-wrap ahover background-color3
line-height 20px padding3
font-size 14px float3
14px float left3
float left ffwdcontainer103
facebook 1 year3
20px line-height 20px3
push if tdscreenwidth3
mccartney death rumor3
min-height 20px line-height3
urlhttpwwwalternativenationnetwp-contentpluginswd-facebook-feedimagesfeedlikegraypng no-repeat 3px3
song brett buchanan3
border-style none outline3
0px 0px 24px3
background-size 16px width3
music8217 song brett3
16px width 20px3
background urlhttpwwwalternativenationnetwp-contentpluginswd-facebook-feedimagesfeedtimegraypng no-repeat3
rgb165 165 1653
background urlhttpwwwalternativenationnetwp-contentpluginswd-facebook-feedimagesfeedlikegraypng no-repeat3
color 656565 outline3
0px 0px 5px3
border-top-style solid border-width3
0px 0px text-align3
text-align left ffwdcontainer103
width 100 height3
underline outline none3
text-decoration underline outline3
656565 outline none3
cursor pointer ffwdcontainer103
0px padding 0px3
pointer ffwdcontainer10 ffwdcontainer203
000000 font-size 14px3
bold color 6666663
important ffwdcontainer10 ffwdcontainer203
margin 4px 0px3
box-sizing border-box ffwdcontainer103
border-box ffwdcontainer10 ffwdcontainer203
padding 3px 0px3
font-family inherit font-size3
ffwdcontainer20 blogstyleobjectsconteiner0 ffwdblogstyleheadercontainer03
blake red premieres3
font-variant initial color3
red premieres masterpiece3
premieres masterpiece 8220follow3
000000 font-weight normal3
165 ffwdcontainer10 ffwdcontainer203
165 165 ffwdcontainer103
center background-size 12px3
color rgb165 1653
initial color rgb1653
inherit font-variant initial3
ffwdcomment0 ffwdcommentreply0 ffwdcommentreplycontent03
font-family inherit font-variant3
masterpiece 8220follow me82213
8220follow me8221 video3
10px font-weight normal3
background-size 10px font-weight3
center background-size 10px3
tweets by altnationnet3
ffwdcomment0 ffwdcommentcontent0 ffwdcommentreplies03
0px text-decoration none3
ffwdcontainer10 ffwdcontainer20117
0px 0px46
ffwdcontainer20 blogstyleobjectcontainer043
font-family inherit35
font-weight normal29
outline none27
font-size 14px24
center background-size21
color 00000021
border-style none20
ffwdcontainer20 ffwdblogstyleobjectinfocontainer019
blogstyleobjectcontainer0 ffwdcomment018
normal font-size17
float left17
none border-style17
margin 0px16
inherit font-weight15
none ffwdcontainer1015
brett buchanan13
buchanan mar13
blogstyleobjectcontainer0 ffwdlikesnamescount013
stone temple12
temple pilots12
padding 0px12
3px center12
2021 012
no-repeat 3px12
color 65656511
box-sizing border-box11
read more10
adsbygoogle windowadsbygoogle10
0px ffwdcontainer1010
windowadsbygoogle push10
text-align center10
normal font-family10
display block10
width 1009
ffwdcomment0 ffwdcommentcontent09
pearl jam9
mar 269
font-weight bold9
26 20219
jason newsted8
25 20218
no-repeat center8
text-align left8
vertical-align middle8
position relative8
mar 258
none outline8
center center8
display inline-block7
text-decoration none7
dave grohl7
block height7
functione epreventdefault7
height 22px6
8216tiny music82176
cursor pointer6
left display6
000000 font-size6
000000 font-family6
ffwdlikesnamescount0 ffwdlikesnames06
font-size 13px6
4px 0px6
22px background6
0px text-align6
blogstyleobjectcontainer0 ffwdcommentscontent06
ffwdcontainer20 ffwdblogstyleobjectveral06
text-decoration underline6
foo fighters6
left ffwdcontainer106
none color6
width 20px6
height 1005
000000 font-weight5
14px font-family5
ffwdcontainer20 blogstyleobjectsconteiner05
14px font-weight5
10px 0px5
background-color ffffff5
border-width 1px5
inherit ffwdcontainer105
20px margin-left5
font-size 12px5
spiderpage0this 15
function spiderpage0this5
return false5
display none5
new tdblock5
margin-left -2px5
25th anniversary5
ffwdcontainer20 tablenav-pages05
-2px ffwdcontainer105
deep cuts5
padding 3px4
3px 0px4
reveal sad4
vatican gift4
newsted tour4
sad jason4
metallica reveal4
seattle concerts4
play huge4
solid border-width4
huge seattle4
1px border-color4
inherit color4
13px font-weight4
tiny musicsongs4
new 8216tiny4
jam rumored4
0px 4px4
angry view4
sad angry4
wow sad4
haha wow4
love haha4
like love4
year ago4
1 year4
background-size 18px4
ffwdcontainer20 ffwdshare04
line-height 20px4
font-style normal4
min-height 20px4
background-size 16px4
656565 font-family4
ffwdlikesnames0 ffwdlikenamecont04
14px ffwdcontainer104
ffwdcomment0 ffwdcommentreplycontent04
pilots releasing4
releasing new4
ffwdcomment0 ffwdcommentreply04
music8217 song4
ffwdcommentscontent0 ffwdviewmorecommentscont04
0px padding4
if tdscreenwidth4
none important4
0 stone4
0 04
relative ffwdcontainer104
1e73be tduid5605e781e8140crand4
dd3333 tduid7605e781e83beerand4
max-width 1004
push adsbygoogle4
top 104
mike mazzarone4
24 20214
mar 244
margin 10px4
4db2ec tduid3605e781e7df6erand4
position absolute4
border-top-style solid4
fighters react4
8216not playing82174
gift shop4
documentwrite adsbygoogle4
blake red4
major album4
tour secret4
bold color4
12px font-family4
news like3
photo jan3
break case3
16px width3
tduid7605e781e83beerand block-title3
tduid5605e781e8140crand block-title3
background-color dd33333
documentgetelementbyidpagenumber0value 13
background-color 1e73be3
14px float3
block-title border-color3
td-weather-weekbefore background-color3
urlhttpwwwalternativenationnetwp-contentpluginswd-facebook-feedimagesfeedlikegraypng no-repeat3
background urlhttpwwwalternativenationnetwp-contentpluginswd-facebook-feedimagesfeedlikegraypng3
ozzy osbourne3
20px padding3
20px line-height3
paul mccartney3
premieres masterpiece3
masterpiece 8220follow3
8220follow me82213
me8221 video3
unheard 19963
death rumor3
mccartney death3
red premieres3
2019 13
vicky cornell3
tduid3605e781e7df6erand block-title3
x 13
major legal3
1 break3
float right3
0px 24px3
facebook 13
block-title span3
inherit font-variant3
165 ffwdcontainer103
background-size 12px3
td-next-prev-wrap ahover3
tdquoteonblocks color3
0px text-decoration3
100 height3
td-subcat-item td-cur-simple-item3
td-subcat-item ahover3
tdmodulewraphover entry-title3
z-index 13
transition all3
urlhttpwwwalternativenationnetwp-contentpluginswd-facebook-feedimagesfeedtimegraypng no-repeat3
0px 5px3
background urlhttpwwwalternativenationnetwp-contentpluginswd-facebook-feedimagesfeedtimegraypng3
pointer ffwdcontainer103
important width3
filter alphaopacity703
all 03s3
color 6666663
border-box ffwdcontainer103
float none3
margin 4px3
656565 outline3
underline outline3
165 1653
td-subcat-dropdownhover td-subcat-more3
rgb165 1653
color rgb1653
initial color3
font-variant initial3
important ffwdcontainer103
push if3
10px font-weight3
background-size 10px3
td-post-categoryhover background-color3
ffwdcommentcontent0 ffwdcommentreplies03
td-load-more-wrap ahover3
ffwdcommentreply0 ffwdcommentreplycontent03
width 324px3
blogstyleobjectsconteiner0 ffwdblogstyleheadercontainer03
background-color 4db2ec3
background-color 0000003
ahover background-color3
song brett3
opacity 13
background-color eaeaea3
inherit font-size3
text-align justify3
ffwdcontainer10119
ffwdcontainer20118
0px100
none70
color49
blogstyleobjectcontainer043
center39
font-size38
font-weight38
037
normal35
inherit35
font-family35
131
left28
margin28
outline27
display26
00000024
14px24
float23
223
padding23
background-color23
border-style22
var22
width21
no-repeat21
text-align21
background21
background-size21
mar21
new20
320
ffwdblogstyleobjectinfocontainer019
3px18
ffwdcomment018
tduid7605e781e83beerand16
tduid5605e781e8140crand16
tduid3605e781e7df6erand16
height15
20px14
if14
text-decoration13
buchanan13
brett13
metallica13
border-box13
ffwdlikesnamescount013
border-color12
top12
10px12
position12
pilots12
stone12
temple12
block12
box-sizing11
function11
more11
4px11
411
511
read10
vertical-align10
opacity10
jquerybodyonclick10
push10
windowadsbygoogle10
adsbygoogle10
bold10
margin-left9
block-title9
functione9
ahover9
ffwdcommentcontent09
69
important9
pearl9
sad9
jam9
relative8
dave8
18px8
12px8
grohl8
22px8
transition8
middle8
return8
solid8
rock8
seattle8
song8
jason8
newsted8
78
documentgetelementbyidpagenumber0value7
foo7
album7
reveal7
13px7
tour7
all7
dd33337
1e73be7
inline-block7
0s7
87
97
5px7
ffwdcommentreplycontent07
cursor7
tdscreenwidth7
major7
4db2ec7
epreventdefault7
max-width7
play6
line-height6
border-width6
td-subcat-item6
ffffff6
106
z-index6
fighters6
false6
pointer6
03s6
ffwdblogstyleobjectveral06
interviews6
8216tiny6
underline6
video6
ffwdlikesnames06
ffwdcommentscontent06
releasing6
music82176
116
cuts5
band5
font-variant5
like5
deep5
16px5
spiderpage0this5
125
anniversary5
25th5
1px5
tdblock5
-2px5
have5
6px5
jan5
transform5
x5
filter5
visibility5
min-height5
news5
linear5
tablenav-pages05
blogstyleobjectsconteiner05
border-radius5
ffwdviewmorecommentscont04
absolute4
documentwrite4
ffwdcommentreply04
playing82174
secret4
react4
rumored4
8216not4
concerts4
img4
font-style4
ffwdlikenamecont04
huge4
wow4
facebook4
blake4
view4
revealed4
paul4
angry4
year4
he4
02s4
ago4
ffwdshare04
jquerythisparentfindmoredotescssdisplay4
out4
death4
red4
mazzarone4
cornell4
could4
shop4
border-top-style4
jquerythishtmlsee4
inline4
break4
love4
span4
haha4
case4
itemscounty04
loadmore4
tiny4
musicsongs4
vatican4
gift4
mike4
mccartney3
rumor3
rgb1653
y3
arrlength3
initial3
transparent3
ffwdtooltip03
urlhttpwwwalternativenationnetwp-contentpluginswd-facebook-feedimagesfeedlikegraypng3
scale123
ffwdreacts03
ffwdsharebutton03
right3
eddie3
24px3
else3
feature3
box-shadow3
ffwdcommentreplies03
td-weather-informationbefore3
soundgarden3
133
unheard3
me82213
8220follow3
masterpiece3
premieres3
heard3
before3
never3
td-weather-weekbefore3
td-read-more3
legal3
td-trending-now-title3
td-post-categoryhover3
td-subcat-more3
td-subcat-dropdownhover3
td-load-more-wrap3
td-next-prev-wrap3
tdquoteonblocks3
td-cur-simple-item3
atd-pulldown-filter-linkhover3
entry-title3
tdmodulewraphover3
vicky3
addiction3
17px3
had3
eaeaea3
ffwdtitlespun103
urlhttpwwwalternativenationnetwp-contentpluginswd-facebook-feedimagesfeedtimegraypng3
justify3
alphaopacity703
143
ffwdblogstyleheadercontainer03
auto3
324px3
30px3
concert3
altnationnet3
celebrate3
tweets3
photo3
153
osbourne3
ozzy3
classic3
alternative3
chris3
may3
163
leave3
want3
arrsplitsi3

Who hosts Alternativenation.net?

Alternativenation.net Hosting Provider Information

Hosted IP Address:192.124.249.162
Hosted Hostname:cloudproxy10162.sucuri.net
Service Provider:Sucuri
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Sucuri/Cloudproxy

Is "Sucuri" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
Sucuri
0.0878%

HTTP Header Analysis for Alternativenation.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Sucuri/Cloudproxy
Date: Sat, 27 Mar 2021 00:11:09 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Sucuri-ID: 13012
X-XSS-Protection: 1; mode=block
X-Frame-Options: SAMEORIGIN
X-Content-Type-Options: nosniff
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Link:; rel="https://api.w.org/", ; rel=shortlink
Content-Encoding: gzip
Vary: Accept-Encoding
X-Sucuri-Cache: EXPIRED

Alternativenation.net Domain Nameserver Information

HostIP AddressCountry
ns41.domaincontrol.com 97.74.100.21
ns42.domaincontrol.com 173.201.68.21


Need to find out who hosts Alternativenation.net?


Domain Registration (WhoIs) information for Alternativenation.net

 Domain Name: ALTERNATIVENATION.NET
Registry Domain ID: 1660766162_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2020-02-26T03:01:07Z
Creation Date: 2011-06-09T13:56:50Z
Registrar Registration Expiration Date: 2022-06-09T13:56:50Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization:
Registrant State/Province: California
Registrant Country: US
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=ALTERNATIVENATION.NET
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=ALTERNATIVENATION.NET
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=ALTERNATIVENATION.NET
Name Server: NS41.DOMAINCONTROL.COM
Name Server: NS42.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-03-27T00:11:10Z

Websites with Similar Names

Alter-agora.com
ALTER AGORA
Alter-algo.biz
Félicitations ! Votre domaine a bien été créé chez OVH !
Alter-algo.com
Site not installed
Alter-algo.net
Félicitations ! Votre domaine a bien été créé chez OVH !
Alter-algo.org
Félicitations ! Votre domaine a bien été créé chez OVH !
Alter-and-go.com
Personnalisez votre bière - avec votre étiquette réalisez un produit unique!

Recently Updated Websites

Mainpress.nl (2 seconds ago.)9399ss.com (2 seconds ago.)Colleenraye.com (4 seconds ago.)Carmenalarconcollignon.com (5 seconds ago.)Illinoisjewelrystores.com (5 seconds ago.)Takesan66.com (5 seconds ago.)Tires-direct.com (6 seconds ago.)Getdailyupdates.com (9 seconds ago.)Greenshieldtec.net (9 seconds ago.)Northwalesvapour.org (9 seconds ago.)Clarionllc.net (10 seconds ago.)Takeoffclothingshop.com (10 seconds ago.)Tianjin-fp.com (12 seconds ago.)Tv-fiawtcc.biz (12 seconds ago.)Ultimatetopics.com (13 seconds ago.)Pechepoissonsdeschenaux.com (14 seconds ago.)022585.com (14 seconds ago.)Qt31.com (14 seconds ago.)Cellshop.com (16 seconds ago.)Portalvideogay.com (17 seconds ago.)Solomonchevroletcadillac.com (18 seconds ago.)Everdrychicago.com (18 seconds ago.)Mrmarketofhk.blogspot.hk (18 seconds ago.)Rockhavenmovie.com (19 seconds ago.)Chilebot.cl (19 seconds ago.)Watersue.com (19 seconds ago.)Animevost.com (19 seconds ago.)Stafftx.com (20 seconds ago.)Lifeabovethecanopy.com (20 seconds ago.)Infinitygestions.com (21 seconds ago.)

Recently Searched Keywords

xem bi nhn (1 second ago.)imageid (1 second ago.)all black kaepernick jersey (1 second ago.)xe may (2 seconds ago.)panasonic lumix fz300 long zoom digital camera features 12.1 megapixel, 1 (2 seconds ago.)好玩的手机游戏 (3 seconds ago.)forum 2020 (4 seconds ago.)xa hoi (4 seconds ago.)basket 0 items £0.00 (5 seconds ago.)03 filteropacity (5 seconds ago.)robot market place (6 seconds ago.) início (6 seconds ago.)00 45 (7 seconds ago.)shares asia (7 seconds ago.)x giao lnh (7 seconds ago.)windowwidth 992 creatiumscreen (9 seconds ago.)kompresörler (11 seconds ago.)перепела породы (13 seconds ago.)معاونت فرهنگی اجتماعی شهرداری (14 seconds ago.)châu đại dương (15 seconds ago.)passeio de helicptero (15 seconds ago.)x giao (16 seconds ago.)vsolutions (17 seconds ago.)0pxelementor-389 elementor-elementelementor-element-61f20356 (19 seconds ago.)alexandra (20 seconds ago.)[f3] 2020年acca考试f3考试模拟练习 10-22 (20 seconds ago.)lincolnshirechamber (23 seconds ago.)visit blog (24 seconds ago.)3s ease all (25 seconds ago.)totalpricetext (27 seconds ago.)