Amandajohnson.co.za

Website Thumbnail
Checking...
Amanda Johnson

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-22

Amanda Johnson & Co. Suppliers of Textbooks, e-Books, Study Guides, Workbooks, Reading Series etc.


Domain summary

Domain label
amandajohnson
Domain extension
co.za
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is amandajohnson.co.za ranked relative to other sites:

Percentage of visits to amandajohnson.co.za from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Amandajohnson.co.za registered?
A: Amandajohnson.co.za was registered 1 month, 1 week, 3 days, 12 hours, 1 minute, 25 seconds ago on Thursday, October 22, 2020.
Q: When was the WHOIS for Amandajohnson.co.za last updated?
A: The WHOIS entry was last updated 1 month, 1 week, 3 days, 12 hours, 1 minute, 25 seconds ago on Thursday, October 22, 2020.
Q: What are Amandajohnson.co.za's nameservers?
A: DNS for Amandajohnson.co.za is provided by the following nameservers:
  • ns1.host-h.net
  • ns2.host-h.net
  • ns1.dns-h.com
Q: Who is the registrar for the Amandajohnson.co.za domain?
A: The domain has been registered at UniForum Association.
Q: What is the traffic rank for Amandajohnson.co.za?
A: Amandajohnson.co.za has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Amandajohnson.co.za each day?
A: Amandajohnson.co.za receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Amandajohnson.co.za resolve to?
A: Amandajohnson.co.za resolves to the IPv4 address 196.46.184.182.
Q: In what country are Amandajohnson.co.za servers located in?
A: Amandajohnson.co.za has servers located in the South Africa.
Q: What webserver software does Amandajohnson.co.za use?
A: Amandajohnson.co.za is powered by Microsoft-IIS/8.5 webserver.
Q: Who hosts Amandajohnson.co.za?
A: Amandajohnson.co.za is hosted by ABOUTIT-ONLINE in Gauteng, Pretoria, South Africa, 0084.
Q: How much is Amandajohnson.co.za worth?
A: Amandajohnson.co.za has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Amandajohnson.co.za Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Amandajohnson.co.za Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Amandajohnson.co.za

H1 Headings

0 :

H2 Headings

25 :
  1. School Textbook Lists
  2. King Edward VII School
  3. Leeuwenhof Akademie
  4. REDDAM HOUSE WATERFALL ESTATE
  5. REDDAM HOUSE BEDFORDVIEW
  6. Saheti School
  7. St Andrews School for Girls
  8. St Benedict's College & Prep School Bedfordview 2021
  9. St Catherines School Germiston
  10. St Martin's High School
  11. Exam Prep
  12. Physichem Science Study Guide Gr 10
  13. Physichem Science Study Guide Gr 11
  14. Physichem Science Study Guide Gr 12
  15. Asem Visuele Opsomming
  16. Asem Werkboek
  17. Tweede Asem Studiegids
  18. Macrat Dream House Study Guide
  19. The Answer Series Gr 12 Accounting 2-in-1
  20. The Answer Series GR 12 ACCOUNTING 3-in-1
  21. The Answer Series GR 11 ACCOUNTING 3-in-1
  22. The Answer Series Gr 12 Geography 3-in-1
  23. The Answer Series Gr 11 Life Sciences 3-in-1 IEB
  24. The Answer Series Gr 12 PHYSICAL SCIENCES 3-in-1
  25. Mathematics / Wiskunde

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

26 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-33685713-1

Links - Internal

413:
  1. Amandajohnson Register
    http://amandajohnson.co.za/register
  2. Amandajohnson Log in
    http://amandajohnson.co.za/login
  3. Amandajohnson Wishlist (0)
    http://amandajohnson.co.za/wishlist
  4. http://amandajohnson.co.za/
    http://amandajohnson.co.za/
  5. Amandajohnson Home
    http://amandajohnson.co.za/
  6. Amandajohnson Resources
    http://amandajohnson.co.za/RESOURCES
  7. Amandajohnson Requests
    http://amandajohnson.co.za/Requests
  8. Amandajohnson Accounting / Rekeningkunde
    http://amandajohnson.co.za/accounting-rekeningkunde
  9. Amandajohnson Accounting
    http://amandajohnson.co.za/Accounting
  10. Amandajohnson Accounting Grade 10
    http://amandajohnson.co.za/accounting-textbooks
  11. Amandajohnson Accounting Grade 11
    http://amandajohnson.co.za/textbooks-accounting-grade-11
  12. Amandajohnson Accounting Grade 12
    http://amandajohnson.co.za/ACCOUNTING-Grade-12
  13. Amandajohnson Study Guides
    http://amandajohnson.co.za/ACCOUNTING-Study-Guides
  14. Amandajohnson Teachers Guides
    http://amandajohnson.co.za/accounting-teachers-guides
  15. Amandajohnson Rekeningkunde
    http://amandajohnson.co.za/Rekeningkunde
  16. Amandajohnson Rekeningkunde Graad 10
    http://amandajohnson.co.za/Rekeningkunde-Graad-10
  17. Amandajohnson Rekeningkunde Graad 11
    http://amandajohnson.co.za/Rekeningkunde-Graad-11
  18. Amandajohnson Rekeningkunde Graad 12
    http://amandajohnson.co.za/Rekeningkunde-Graad-12
  19. Amandajohnson Studiegidse
    http://amandajohnson.co.za/Rekeningkunde-Studiegidse
  20. Amandajohnson Handleidings
    http://amandajohnson.co.za/Rekeningkunde-Antwoordgidse
  21. Amandajohnson Afrikaans
    http://amandajohnson.co.za/AFRIKAANS-
  22. Amandajohnson Laerskool Lees Afrikaans
    http://amandajohnson.co.za/laerskool-lees-afrikaans
  23. Amandajohnson Afrikaans Readers for Primary School
    http://amandajohnson.co.za/afrikaans-readers-for-primary-school
  24. Amandajohnson Afrikaans Readers for High School
    http://amandajohnson.co.za/afrikaans-readers-for-high-school
  25. Amandajohnson Afrikaans Huistaal
    http://amandajohnson.co.za/afrikaans-huistaal
  26. Amandajohnson Afrikaans Huistaal Gr 1 tot Gr 3
    http://amandajohnson.co.za/afrikaans-huistaal-gr-1-tot-gr-3
  27. Amandajohnson Afrikaans Huistaal Gr 4 tot Gr 6
    http://amandajohnson.co.za/afrikaans-huistaal-gr-4-gr-5-gr-6
  28. Amandajohnson Afrikaans Huistaal Gr 7 tot Gr 9
    http://amandajohnson.co.za/afrikaans-huistaal-gr-7-gr-8-gr-9
  29. Amandajohnson Afrikaans Huistaal Gr 7
    http://amandajohnson.co.za/afrikaans-huistaal-handboeke-gr-7
  30. Amandajohnson Afrikaans Huistaal Gr 8
    http://amandajohnson.co.za/afrikaans-huistaal-graad-8-boeke
  31. Amandajohnson Afrikaans Huistaal Gr 9
    http://amandajohnson.co.za/afrikaanse-huistaal-handboeke-gr-9
  32. Amandajohnson Afrikaans Huistaal Gr 10 tot Gr 12
    http://amandajohnson.co.za/afrikaans-huistaal-gr-10-gr-11-gr-12
  33. Amandajohnson Afrikaans Huistaal Studiegidse
    http://amandajohnson.co.za/Afrikaans-Huistaal-Studiegidse
  34. Amandajohnson Huistaal Onderwyserhandleidings
    http://amandajohnson.co.za/afrikaans-huistaal-onderwyserhandleidings
  35. Amandajohnson Afrikaans First Additional Language
    http://amandajohnson.co.za/Afrikaans-First-Additional-Language
  36. Amandajohnson Afrikaans FAL Gr 1 to Gr 3
    http://amandajohnson.co.za/afrikaans-fal-gr-1-gr-2-gr-3
  37. Amandajohnson Afrikaans FAL Gr 4 to Gr 6
    http://amandajohnson.co.za/afrikaans-fal-gr-4-gr-5-gr-6
  38. Amandajohnson Afrikaans FAL Gr 7 to Gr 9
    http://amandajohnson.co.za/afrikaans-fal-gr-7-gr-8-gr-9
  39. Amandajohnson Afrikaans FAL Gr 10 to Gr 12
    http://amandajohnson.co.za/afrikaans-fal-gr-10-gr-11-gr-12
  40. Amandajohnson Afrikaans FAL Study Guides
    http://amandajohnson.co.za/AFRIKAANS-FAL-STUDY-GUIDES
  41. Amandajohnson FAL Teachers Guide
    http://amandajohnson.co.za/AFRIKAANS-FAL-TEACHER-S-GUIDES
  42. Amandajohnson Afrikaans FAL Workbooks for Primary School
    http://amandajohnson.co.za/afrikaans-fal-workbooks-for-primary-school
  43. Amandajohnson Hoerskool Lees Afrikaans
    http://amandajohnson.co.za/hoerskool-lees-afrikaans
  44. Amandajohnson Agriculture / Landbou
    http://amandajohnson.co.za/agricultural-landbou-
  45. Amandajohnson Agricultural Sciences
    http://amandajohnson.co.za/agricultural-sciences-landbouwetenskappe
  46. Amandajohnson Agricultural Sciences Study Guides
    http://amandajohnson.co.za/agricultural-sciences-study-guides
  47. Amandajohnson Agricultural Sciences Teachers Guides
    http://amandajohnson.co.za/agricultural-sciences-teachers-guide
  48. Amandajohnson Landbouwetenskappe
    http://amandajohnson.co.za/Landbouwetenskappe
  49. Amandajohnson Landbouwetenskappe Studiegidse
    http://amandajohnson.co.za/landbouwetenskappe-studiegidse
  50. Amandajohnson Landbouwetenskappe Handleidings
    http://amandajohnson.co.za/landbouwetenskappe-onderwysershandleidings
  51. Amandajohnson Atlases & Mapskills
    http://amandajohnson.co.za/atlases-mapskills-books
  52. Amandajohnson Maps & Wall Maps
    http://amandajohnson.co.za/maps-wall-charts-for-the-social-science-and-geography
  53. Amandajohnson Bibles
    http://amandajohnson.co.za/BIBLES
  54. Amandajohnson Business Studies / Besigheidstudies
    http://amandajohnson.co.za/business-studies-besigheidstudies-
  55. Amandajohnson BUSINESS STUDIES
    http://amandajohnson.co.za/business-studies-gr-10-gr-11-gr-12
  56. Amandajohnson Business Studies Gr 10
    http://amandajohnson.co.za/Business-Studies-Grade-10
  57. Amandajohnson Business Studies Gr 11
    http://amandajohnson.co.za/Business-Studies-Grade-11
  58. Amandajohnson Business Studies Gr 12
    http://amandajohnson.co.za/Business-Studies-Grade-12
  59. Amandajohnson Study Guides
    http://amandajohnson.co.za/Business-Studies-Study-Guides
  60. Amandajohnson Teachers Guides
    http://amandajohnson.co.za/Business-Studies-Teachers-Guides
  61. Amandajohnson Besigheidstudies G 10, Gr 11, Gr 12
    http://amandajohnson.co.za/besigheidstudies-g-10-gr-11-gr-12
  62. Amandajohnson Besigheidstudies Gr 10
    http://amandajohnson.co.za/Besigheidstudies-Gr-10
  63. Amandajohnson Besigheidstudies Gr 11
    http://amandajohnson.co.za/Besigheidstudies-Gr-11
  64. Amandajohnson Besigheidstudies Gr 12
    http://amandajohnson.co.za/Besigheidstudies-Gr-12
  65. Amandajohnson Studiegidse
    http://amandajohnson.co.za/Besigheidstudies-Studiegidse
  66. Amandajohnson Handleidings
    http://amandajohnson.co.za/Besigheidstudies-Onderwysershandleidings
  67. Amandajohnson Computer Studies / Rekenaarstudies
    http://amandajohnson.co.za/computer-studies-rekenaarstudies
  68. Amandajohnson C A T
    http://amandajohnson.co.za/Computer-Applications-Technology
  69. Amandajohnson Rekenaarstudies
    http://amandajohnson.co.za/rekenaars-toepassings-tegnologie
  70. Amandajohnson Information Technology
    http://amandajohnson.co.za/Information-Technology
  71. Amandajohnson Consumer Studies / Verbruikerstudies
    http://amandajohnson.co.za/consumer-studies-verbruikerstudies
  72. Amandajohnson Consumer Studies
    http://amandajohnson.co.za/Consumer-Studies
  73. Amandajohnson Verbruikers Studies
    http://amandajohnson.co.za/Verbruikers-Studies
  74. Amandajohnson Creative Art / Kreatiewe Kuns
    http://amandajohnson.co.za/creative-art-kreatiewe-kuns
  75. Amandajohnson Creative Arts
    http://amandajohnson.co.za/creative-arts-teachers-guides-gr-7-to-gr-9
  76. Amandajohnson Creative Arts Gr 7
    http://amandajohnson.co.za/creative-arts-textbooks-for-gr-7
  77. Amandajohnson Creative Arts Gr 8
    http://amandajohnson.co.za/creative-arts-textbooks-gr-8
  78. Amandajohnson Creative Arts Gr 9
    http://amandajohnson.co.za/creative-arts-gr-9-textbooks
  79. Amandajohnson Teachers Guides
    http://amandajohnson.co.za/creative-arts-teachers-guides-gr-7-to-gr-9-2
  80. Amandajohnson Kreatiewe Kuns
    http://amandajohnson.co.za/Kreatiewe-Kuns
  81. Amandajohnson Kreatiewe Kuns Gr 7
    http://amandajohnson.co.za/kreatiewe-kuns-boeke-gr-7
  82. Amandajohnson Kreatiewe Kuns Gr 8
    http://amandajohnson.co.za/kreatiewe-kuns-graad-8-boeke
  83. Amandajohnson Kreatiewe Kuns Gr 9
    http://amandajohnson.co.za/kreatiewe-kuns-graad-9-boeke
  84. Amandajohnson Handleidings
    http://amandajohnson.co.za/kreatiewe-kuns-onderwysershandleidings
  85. Amandajohnson Design / Ontwerp
    http://amandajohnson.co.za/design-ontwerp-
  86. Amandajohnson Design
    http://amandajohnson.co.za/Design
  87. Amandajohnson Ontwerp
    http://amandajohnson.co.za/Ontwerp
  88. Amandajohnson Dictionaries / Woordeboeke
    http://amandajohnson.co.za/dictionaries-woordeboeke
  89. Amandajohnson Afrikaanse Woordeboeke
    http://amandajohnson.co.za/Afrikaanse-Woordeboeke
  90. Amandajohnson English Dictionaries
    http://amandajohnson.co.za/English-Dictionaries
  91. Amandajohnson English / Afrikaans Dictionaries
    http://amandajohnson.co.za/english-afrikaans-dictionaries
  92. Amandajohnson Thesaurus
    http://amandajohnson.co.za/Thesauri
  93. Amandajohnson English / Zulu Dictionaries
    http://amandajohnson.co.za/english-zulu-dictionaries
  94. Amandajohnson English / Greek Dictionaries
    http://amandajohnson.co.za/english-greek-dictionaries
  95. Amandajohnson Subject Dictionaries
    http://amandajohnson.co.za/Subject-Dictionaries
  96. Amandajohnson Dramatic Arts / Dramatiese Kunste
    http://amandajohnson.co.za/DRAMATIC-ARTS-
  97. Amandajohnson Plays for Dramatic Arts
    http://amandajohnson.co.za/Plays-for-Dramatic-Arts
  98. Amandajohnson Dramatic Art
    http://amandajohnson.co.za/Dramatic-Art
  99. Amandajohnson Economics / Ekonomie
    http://amandajohnson.co.za/economics-ekonomie-
  100. Amandajohnson ECONOMICS
    http://amandajohnson.co.za/economics-gr-10-gr-11-gr-12
  101. Amandajohnson Economics Gr 10
    http://amandajohnson.co.za/economics-grade-10-textbooks
  102. Amandajohnson Economics Gr 11
    http://amandajohnson.co.za/economics-grade-11-textbooks
  103. Amandajohnson Economics Gr 12
    http://amandajohnson.co.za/economics-grade-12-textbooks
  104. Amandajohnson Study Guides
    http://amandajohnson.co.za/Economics-Study-Guides-Gr-10-to-Gr-12
  105. Amandajohnson Teachers Guides
    http://amandajohnson.co.za/Economics-Teachers-Guides
  106. Amandajohnson Ekonomie
    http://amandajohnson.co.za/Ekonomie
  107. Amandajohnson Ekonomie Gr 10
    http://amandajohnson.co.za/ekonomie-graad-10-handboeke
  108. Amandajohnson Ekonomie Gr 11
    http://amandajohnson.co.za/ekonomie-graad-11-handboeke
  109. Amandajohnson Ekonomie Gr 12
    http://amandajohnson.co.za/ekonomie-graad-12-handboeke
  110. Amandajohnson Studiegidse
    http://amandajohnson.co.za/Ekonomie-Studiegidse-1
  111. Amandajohnson Handleidings
    http://amandajohnson.co.za/Ekonomie-Onderwysershandleidings
  112. Amandajohnson EGD / IGO
    http://amandajohnson.co.za/egd-igo
  113. Amandajohnson ENGINEERING GRAPICS & DESIGN
    http://amandajohnson.co.za/engineering-grapics-design
  114. Amandajohnson INGENIEURS GRAFIKA & ONTWERP
    http://amandajohnson.co.za/ingenieurs-grafika-ontwerp
  115. Amandajohnson EMS / EBW
    http://amandajohnson.co.za/ems-ebw
  116. Amandajohnson Economic and Management Sciences
    http://amandajohnson.co.za/Economic-and-Management-Sciences
  117. Amandajohnson E.M.S Gr 7
    http://amandajohnson.co.za/Economic-and-Management-Sciences-Gr-7
  118. Amandajohnson E.M.S Gr 8
    http://amandajohnson.co.za/Economic-and-Management-Sciences-Gr-8
  119. Amandajohnson E.M.S Gr 9
    http://amandajohnson.co.za/Economic-and-Management-Sciences-Gr-9-Textbooks
  120. Amandajohnson Teachers Guides
    http://amandajohnson.co.za/Economic-and-Management-Sciences-Teacher-s-Guides
  121. Amandajohnson Ekonomiese en Bestuurwetenskappe
    http://amandajohnson.co.za/Ekonomiese-en-Bestuurwetenskappe
  122. Amandajohnson E.B.W Gr 7
    http://amandajohnson.co.za/ekonomiese-en-bestuurwetenskappebr-gr-7
  123. Amandajohnson E.B.W Gr 8
    http://amandajohnson.co.za/Ekonomiese-en-Bestuurwetenskappe-GR-8
  124. Amandajohnson E.B.W Gr 9
    http://amandajohnson.co.za/Ekonomiese-en-Bestuurwetenskappe-Gr-9
  125. Amandajohnson Handleidings
    http://amandajohnson.co.za/EBW-Onderwysershandleidings
  126. Amandajohnson English
    http://amandajohnson.co.za/ENGLISH
  127. Amandajohnson English Study Guides & Workbooks (Home Language)
    http://amandajohnson.co.za/english-home-language-literature-study-guides
  128. Amandajohnson English Literature
    http://amandajohnson.co.za/English-Literature
  129. Amandajohnson English Literature for Primary School
    http://amandajohnson.co.za/English-Literature-for-Primary-School
  130. Amandajohnson Shakespeare for School
    http://amandajohnson.co.za/Shakespeare-for-School
  131. Amandajohnson Matric Setworks
    http://amandajohnson.co.za/matric-setworks-for-ieb-dbe
  132. Amandajohnson English Literature for High School
    http://amandajohnson.co.za/English-Literature-for-High-School
  133. Amandajohnson Advanced Programme English
    http://amandajohnson.co.za/advanced-programme-english-2
  134. Amandajohnson Film Studies
    http://amandajohnson.co.za/Film-Studies-for-English-Set-works
  135. Amandajohnson English First Additional Language
    http://amandajohnson.co.za/English-1st-Additional-Language
  136. Amandajohnson English FAL Gr 1 - Gr 3
    http://amandajohnson.co.za/english-fal-gr-1-gr-3
  137. Amandajohnson English FAL Resources for GR 1 to Gr 3
    http://amandajohnson.co.za/english-fal-resources-for-gr-1-to-gr-3
  138. Amandajohnson English FAL Gr 4 - Gr 6
    http://amandajohnson.co.za/english-1st-additional-language-4-5-6
  139. Amandajohnson English First Additional Language Gr 7 to Gr 9
    http://amandajohnson.co.za/english-1st-additional-language-7-8-9
  140. Amandajohnson English FAL Gr 10 to Gr 12
    http://amandajohnson.co.za/english-1st-additional-language-10-11-12
  141. Amandajohnson English FAL Teachers Guides
    http://amandajohnson.co.za/English-1st-Additional-Language-Teachers-Guides
  142. Amandajohnson English FAL Study Guides
    http://amandajohnson.co.za/english-first-additional-language-study-guides
  143. Amandajohnson English Literature Study Guides
    http://amandajohnson.co.za/English-Literature-Study-Guides
  144. Amandajohnson English Home Lanuage
    http://amandajohnson.co.za/English-Home-Lanuage
  145. Amandajohnson English HL Gr 7 - Gr 9
    http://amandajohnson.co.za/english-hl-gr-7-gr-8-gr-9
  146. Amandajohnson English HL Gr 10 - Gr 12
    http://amandajohnson.co.za/english-hl-gr-10-gr-11-gr-12
  147. Amandajohnson HL Teachers Guides
    http://amandajohnson.co.za/English-HL-Teachers-Guides
  148. Amandajohnson English Home Language Gr 1 to Gr 3
    http://amandajohnson.co.za/english-home-language-gr-1-to-gr-3
  149. Amandajohnson English HL Gr 4 - Gr 6
    http://amandajohnson.co.za/english-hl-gr-4-gr-5-gr-6
  150. Amandajohnson French
    http://amandajohnson.co.za/FRENCH
  151. Amandajohnson Geography / Geografie
    http://amandajohnson.co.za/geography-geografie-
  152. Amandajohnson Geography
    http://amandajohnson.co.za/geography-textbooks-for-high-school
  153. Amandajohnson Geography Grade 10
    http://amandajohnson.co.za/geography-textbooks-for-high-school-2
  154. Amandajohnson Geography Grade 11
    http://amandajohnson.co.za/geography-textbooks-grade-11
  155. Amandajohnson Geography Grade 12
    http://amandajohnson.co.za/geography-grade-12
  156. Amandajohnson Study Guides
    http://amandajohnson.co.za/geography-study-guides-2
  157. Amandajohnson Teachers Guide
    http://amandajohnson.co.za/geography-teachers-guide
  158. Amandajohnson Geografie
    http://amandajohnson.co.za/Geografie
  159. Amandajohnson Geografie Graad 10
    http://amandajohnson.co.za/geografie-graad-10
  160. Amandajohnson Geografie Graad 11
    http://amandajohnson.co.za/geografie-graad-11
  161. Amandajohnson Geografie Graad 12
    http://amandajohnson.co.za/geografie-graad-12
  162. Amandajohnson Studiegids
    http://amandajohnson.co.za/geografie-studiegids
  163. Amandajohnson Handleidings
    http://amandajohnson.co.za/geografie-onderwysershandleidings
  164. Amandajohnson History/ Geskiedenis
    http://amandajohnson.co.za/history-geskiedenis-
  165. Amandajohnson History
    http://amandajohnson.co.za/History
  166. Amandajohnson History Gr 10
    http://amandajohnson.co.za/HISTORY-Gr-10
  167. Amandajohnson History Gr 11
    http://amandajohnson.co.za/HISTORY-Gr-11
  168. Amandajohnson History Gr 12
    http://amandajohnson.co.za/HISTORY-Gr-12
  169. Amandajohnson Study Guides
    http://amandajohnson.co.za/history-study-guides
  170. Amandajohnson Teachers Guides
    http://amandajohnson.co.za/HISTORY-Teacher-s-Guides
  171. Amandajohnson Geskiedenis
    http://amandajohnson.co.za/Geskiedenis
  172. Amandajohnson Geskiedenis Gr 10
    http://amandajohnson.co.za/geskiedenis-boeke-graad-10
  173. Amandajohnson Geskiedenis Gr 11
    http://amandajohnson.co.za/geskiedenis-boeke-graad-11
  174. Amandajohnson Geskiedenis Gr 12
    http://amandajohnson.co.za/geskiedenis-boeke-graad-12
  175. Amandajohnson Handleidings
    http://amandajohnson.co.za/geskiedenis-onderwysershandleidings
  176. Amandajohnson Studiesgidse
    http://amandajohnson.co.za/geskiedenis-studiesgidse
  177. Amandajohnson Hospitality Studies / Gasvryheidstudies
    http://amandajohnson.co.za/hospitality-studies-brgasvryheidstudies-
  178. Amandajohnson HOSPITALITY STUDIES
    http://amandajohnson.co.za/HOSPITALITY-STUDIES
  179. Amandajohnson GASVRYHEIDSTUDIES
    http://amandajohnson.co.za/GASVRYHEIDSTUDIES
  180. Amandajohnson isiZulu
    http://amandajohnson.co.za/ISIZULU
  181. Amandajohnson isiZulu Literature for High School
    http://amandajohnson.co.za/isiZulu-Literature-for-High-School
  182. Amandajohnson isiZulu Study Guides
    http://amandajohnson.co.za/isiZulu-Study-Guides
  183. Amandajohnson Life Sciences / Lewenswetenskap
    http://amandajohnson.co.za/life-sciences-brlewenswetenskap-
  184. Amandajohnson LIFE SCIENCES
    http://amandajohnson.co.za/LIFE-SCIENCES
  185. Amandajohnson Life Sciences Gr 10
    http://amandajohnson.co.za/LIFE-SCIENCE-GR-10
  186. Amandajohnson Life Sciences Gr 11
    http://amandajohnson.co.za/LIFE-SCIENCES-GR-11
  187. Amandajohnson Life Sciences Gr 12
    http://amandajohnson.co.za/LIFE-SCIENCES-GR-12
  188. Amandajohnson Study Guides
    http://amandajohnson.co.za/STUDY-GUIDES-
  189. Amandajohnson Teachers Guides
    http://amandajohnson.co.za/TEACHERS-GUIDES-1
  190. Amandajohnson LEWENSWETENSKAPPE
    http://amandajohnson.co.za/LEWENSWETENSKAPPE
  191. Amandajohnson Lewenswetenskappe Gr 10
    http://amandajohnson.co.za/lewenswetenskappe-boeke-gr-10
  192. Amandajohnson Lewenswetenskappe Gr 11
    http://amandajohnson.co.za/lewenswetenskappe-graad-11
  193. Amandajohnson Lewenswetenskappe Gr 12
    http://amandajohnson.co.za/lewenswetenskappe-graad-12
  194. Amandajohnson Studiegidse
    http://amandajohnson.co.za/LEWENSWETENSKAPPE-Studiegidse
  195. Amandajohnson Handleidings
    http://amandajohnson.co.za/LEWENSWETENSKAPPE-Onderwysershandleidings
  196. Amandajohnson Life Orientation/ Lewensorientering
    http://amandajohnson.co.za/life-orientation-lewensorientering
  197. Amandajohnson Life Orientation
    http://amandajohnson.co.za/Life-Orientation
  198. Amandajohnson Life Skills Gr 1
    http://amandajohnson.co.za/life-skills-gr-1-textbooks
  199. Amandajohnson Life Skills Gr 2
    http://amandajohnson.co.za/life-skills-gr-2-textbooks
  200. Amandajohnson Life Skills Gr 3
    http://amandajohnson.co.za/life-skills-gr-3-textbooks
  201. Amandajohnson Life Skills Gr 4
    http://amandajohnson.co.za/life-skills-gr-4
  202. Amandajohnson Life Skills Gr 5
    http://amandajohnson.co.za/gr-5-life-skills-textbooks
  203. Amandajohnson Life Skills Gr 6
    http://amandajohnson.co.za/gr-6-life-skills-textbooks
  204. Amandajohnson Life Orientation Gr 7
    http://amandajohnson.co.za/life-orientation-gr-7-textbooks
  205. Amandajohnson Life Orientation Gr 8
    http://amandajohnson.co.za/life-orientation-grade-8-textbooks
  206. Amandajohnson View All
    http://amandajohnson.co.za/Life-Orientation
  207. Amandajohnson Lewensorientering
    http://amandajohnson.co.za/Lewensorientering
  208. Amandajohnson Lewensvaardighede Gr 1
    http://amandajohnson.co.za/graad-1-lewensvaardighede-boeke
  209. Amandajohnson Lewensvaardighede Gr 2
    http://amandajohnson.co.za/lewensvaardighede-graad-2-boeke
  210. Amandajohnson Lewensvaardighede Gr 3
    http://amandajohnson.co.za/lewensvaardighede-graad-3-boeke
  211. Amandajohnson Lewensvaardighede Gr 4
    http://amandajohnson.co.za/graad-4-lewensvaardighede-boeke
  212. Amandajohnson Lewensvaardighede Gr 5
    http://amandajohnson.co.za/graad-5-lewensvaardighede-boeke
  213. Amandajohnson Lewensvaardighede Gr 6
    http://amandajohnson.co.za/graad-6-lewensvaardighede-boeke
  214. Amandajohnson Lewensvaardighede Gr 7
    http://amandajohnson.co.za/graad-7-lewensvaardighede-boeke
  215. Amandajohnson Lewensvaardighede Gr 8
    http://amandajohnson.co.za/graad-8-lewensvaardighede-boeke
  216. Amandajohnson View All
    http://amandajohnson.co.za/Lewensorientering
  217. Amandajohnson Mathematics / Wiskunde
    http://amandajohnson.co.za/mathematics-textbooks-gr-1-to-gr-12
  218. Amandajohnson Wiskunde Gr 10-12
    http://amandajohnson.co.za/Wiskunde-Gr-10-12
  219. Amandajohnson Wiskunde Grade 10
    http://amandajohnson.co.za/wiskunde-grade-10
  220. Amandajohnson Wiskunde Grade 11
    http://amandajohnson.co.za/wiskunde-grade-11
  221. Amandajohnson Wiskunde Grade 12
    http://amandajohnson.co.za/wiskunde-grade-12
  222. Amandajohnson Studiesgidse
    http://amandajohnson.co.za/STUDIESGIDSE-1
  223. Amandajohnson Handleidings
    http://amandajohnson.co.za/wiskunde-handleidings-vir-graad-10-tot-graad-12
  224. Amandajohnson Mathematics Gr 4-6
    http://amandajohnson.co.za/Mathematics-Gr-4-6
  225. Amandajohnson Mathematics Grade 4
    http://amandajohnson.co.za/mathematics-grade-4
  226. Amandajohnson Mathematics Grade 5
    http://amandajohnson.co.za/mathematics-grade-5
  227. Amandajohnson Mathematics Grade 6
    http://amandajohnson.co.za/mathematics-grade-6
  228. Amandajohnson Teachers Guide
    http://amandajohnson.co.za/TEACHER-S-GUIDE-3
  229. Amandajohnson Wiskunde Gr 4-6
    http://amandajohnson.co.za/Wiskunde-Gr-4-6
  230. Amandajohnson Wiskunde Grade 4
    http://amandajohnson.co.za/wiskunde-grade-4
  231. Amandajohnson Wiskunde Grade 5
    http://amandajohnson.co.za/wiskunde-grade-5
  232. Amandajohnson Wiskunde Grade 6
    http://amandajohnson.co.za/wiskunde-grade-6
  233. Amandajohnson Handleidings
    http://amandajohnson.co.za/ONDERWYSERSHANDLEIDINGS-8
  234. Amandajohnson Mathematics Gr 7-9
    http://amandajohnson.co.za/mathematics-books-for-gr-7-gr-8-gr-9
  235. Amandajohnson Mathematics Grade 7
    http://amandajohnson.co.za/mathematics-grade-7
  236. Amandajohnson Mathematics Grade 8
    http://amandajohnson.co.za/mathematics-grade-8
  237. Amandajohnson Mathematics Grade 9
    http://amandajohnson.co.za/mathematics-grade-9
  238. Amandajohnson Teachers Guide
    http://amandajohnson.co.za/TEACHER-S-GUIDE-4
  239. Amandajohnson Study Guides
    http://amandajohnson.co.za/STUDY-GUIDES-14
  240. Amandajohnson Wiskunde Gr 7-9
    http://amandajohnson.co.za/Wiskunde-Gr-7-9
  241. Amandajohnson Wiskunde Grade 7
    http://amandajohnson.co.za/wiskunde-grade-7
  242. Amandajohnson Wiskunde Grade 8
    http://amandajohnson.co.za/wiskunde-grade-8
  243. Amandajohnson Wiskunde Grade 9
    http://amandajohnson.co.za/wiskunde-grade-9
  244. Amandajohnson Studiesgidse
    http://amandajohnson.co.za/STUDIESGIDSE-2
  245. Amandajohnson Handleidings
    http://amandajohnson.co.za/ONDERWYSERSHANDLEIDINGS-9
  246. Amandajohnson Mathematics Gr 10-12
    http://amandajohnson.co.za/mathematics-gr-10-gr-11-gr-12
  247. Amandajohnson Mathematics Grade 10
    http://amandajohnson.co.za/mathematics-grade-10
  248. Amandajohnson Mathematics Grade 11
    http://amandajohnson.co.za/mathematics-grade-11
  249. Amandajohnson Mathematics Grade 12
    http://amandajohnson.co.za/mathematics-grade-12
  250. Amandajohnson Study Guides
    http://amandajohnson.co.za/STUDY-GUIDES-15
  251. Amandajohnson Teachers Guides
    http://amandajohnson.co.za/TEACHER-S-GUIDE-5
  252. Amandajohnson Mathematics Gr 1-3
    http://amandajohnson.co.za/mathematics-textbooks-workbooks
  253. Amandajohnson Wiskunde Gr 1-3
    http://amandajohnson.co.za/Wiskunde-Gr-1-3
  254. Amandajohnson Maths Literacy / Wiskunde Geletterdheid
    http://amandajohnson.co.za/maths-literacy-brwiskunde-geletterdheid-
  255. Amandajohnson MATHEMATICAL LITERACY
    http://amandajohnson.co.za/MATHEMATICAL-LITERACY
  256. Amandajohnson Maths Literacy Gr 10
    http://amandajohnson.co.za/MATHEMATICAL-LITERACY-GR-10
  257. Amandajohnson Maths Literacy Gr 11
    http://amandajohnson.co.za/MATHEMATICAL-LITERACY-GR-11
  258. Amandajohnson Maths Literacy Gr 12
    http://amandajohnson.co.za/MATHEMATICAL-LITERACY-GR-12
  259. Amandajohnson Study Guides
    http://amandajohnson.co.za/MATHEMATICAL-LITERACY-STUDY-GUIDES
  260. Amandajohnson Teachers Guides
    http://amandajohnson.co.za/MATHEMATICAL-LITERACY-TEACHER-S-GUIDES
  261. Amandajohnson WISKUNDIGE GELETTERDHEID
    http://amandajohnson.co.za/WISKUNDIGE-GELETTERDHEID
  262. Amandajohnson Wiskundige Geletterdheid Gr 10
    http://amandajohnson.co.za/WISKUNDIGE-GELETTERDHEID-Gr-10
  263. Amandajohnson Wiskundige Geletterdheid Gr 11
    http://amandajohnson.co.za/WISKUNDIGE-GELETTERDHEID-Gr-11
  264. Amandajohnson Wiskundige Geletterdheid Gr 12
    http://amandajohnson.co.za/WISKUNDIGE-GELETTERDHEID-Gr-12
  265. Amandajohnson Handleidings
    http://amandajohnson.co.za/WISKUNDIGE-GELETTERDHEID-ONDERWYSER-HANDLEIDINGS
  266. Amandajohnson Music/ Musiek
    http://amandajohnson.co.za/music-musiek
  267. Amandajohnson Natural Sciences / Natuurwetenskap Gr 4 - 6
    http://amandajohnson.co.za/natural-sciences-natuurwetenskap-gr-4-6
  268. Amandajohnson NATURAL SCIENCE & TECHNOLOGY
    http://amandajohnson.co.za/textbooks-for-natural-science-and-technology
  269. Amandajohnson NATURAL SCIENCE & TECHNOLOGY GR 4
    http://amandajohnson.co.za/natural-science-technology-gr-4
  270. Amandajohnson NATURAL SCIENCE & TECHNOLOGY GR 5
    http://amandajohnson.co.za/natural-science-technology-gr-5
  271. Amandajohnson NATURAL SCIENCE & TECHNOLOGY GR 6
    http://amandajohnson.co.za/natural-science-technology-gr-6
  272. Amandajohnson NATUURWETENSKAPPE & TEGNOLOGIE
    http://amandajohnson.co.za/natuurwetenskappe-tegnologie-
  273. Amandajohnson NATUURWETENSKAPPE & TEGNOLOGIE GR 4
    http://amandajohnson.co.za/natuurwetenskappe-tegnologie-gr-4
  274. Amandajohnson NATUURWETENSKAPPE & TEGNOLOGIE GR 5
    http://amandajohnson.co.za/natuurwetenskappe-tegnologie-gr-5
  275. Amandajohnson NATUURWETENSKAPPE & TEGNOLOGIE GR 6
    http://amandajohnson.co.za/natuurwetenskappe-tegnologie-gr-6
  276. Amandajohnson NATUURWETENSKAPPE & TEGNOLOGIE ONDERWYSERSHANDLEIDINGS
    http://amandajohnson.co.za/natuurwetenskappe-tegnologie-onderwysershandleidings
  277. Amandajohnson Natural Sciences / Natuurwetenskappe Gr 7 - 9
    http://amandajohnson.co.za/natural-sciences-natuurwetenskappe-gr-7-9
  278. Amandajohnson NATURAL SCIENCES GR 7, GR 8 & GR 9
    http://amandajohnson.co.za/natural-sciences-gr-7-gr-8-gr-9
  279. Amandajohnson Natural Sciences Gr 7
    http://amandajohnson.co.za/NATURAL-SCIENCES-GR-7
  280. Amandajohnson Natural Sciences Gr 8
    http://amandajohnson.co.za/NATURAL-SCIENCES-GR-8
  281. Amandajohnson Natural Sciences Gr 9
    http://amandajohnson.co.za/NATURAL-SCIENCES-GR-9
  282. Amandajohnson Teachers Guides
    http://amandajohnson.co.za/NATURAL-SCIENCES-TEACHER-S-GUIDES
  283. Amandajohnson NATUURWETENSKAPPE GR 7, GR 8 & GR 9
    http://amandajohnson.co.za/natuurwetenskappe-gr-7-gr-8-gr-9
  284. Amandajohnson Natuurwetenskappe Gr 7
    http://amandajohnson.co.za/NATUURWETENSKAPPE-GR-7
  285. Amandajohnson Natuurwetenskappe Gr 8
    http://amandajohnson.co.za/NATUURWETENSKAPPE-GR-8
  286. Amandajohnson Natuurwetenskappe Gr 9
    http://amandajohnson.co.za/NATUURWETENSKAPPE-GR-9
  287. Amandajohnson Handleidings
    http://amandajohnson.co.za/NATUURWETENSKAPPE-ONDERWYSERSHANDLEIDINGS
  288. Amandajohnson Physical Science / Fisiese Wetenskappe
    http://amandajohnson.co.za/physical-science-brfisiese-wetenskappe
  289. Amandajohnson PHYSICAL SCIENCES
    http://amandajohnson.co.za/PHYSICAL-SCIENCES-1
  290. Amandajohnson Physical Sciences Gr 10
    http://amandajohnson.co.za/PHYSICAL-SCIENCES-GR-10
  291. Amandajohnson Physical Sciences Gr 11
    http://amandajohnson.co.za/PHYSICAL-SCIENCES-GR-11
  292. Amandajohnson Physical Sciences Gr 12
    http://amandajohnson.co.za/PHYSICAL-SCIENCES-GR-12
  293. Amandajohnson Study Guides
    http://amandajohnson.co.za/PHYSICAL-SCIENCES-STUDY-GUIDES-1
  294. Amandajohnson Teachers Guides
    http://amandajohnson.co.za/PHYSICAL-SCIENCES-TEACHER-S-GUIDES
  295. Amandajohnson FISIESE WETENSKAPPE
    http://amandajohnson.co.za/FISIESE-WETENSKAPPE
  296. Amandajohnson Fisiese Wetenskappe Gr 10
    http://amandajohnson.co.za/FISIESE-WETENSKAPPE-GR-10
  297. Amandajohnson Fisiese Wetenskappe Gr 11
    http://amandajohnson.co.za/FISIESE-WETENSKAPPE-GR-11
  298. Amandajohnson Fisiese Wetenskappe Gr 12
    http://amandajohnson.co.za/FISIESE-WETENSKAPPE-GR-12
  299. Amandajohnson Handleidings
    http://amandajohnson.co.za/FISIESE-WETENSKAPPE-ONDERWYSERSHANDLEIDINGS
  300. Amandajohnson Studiesgidse
    http://amandajohnson.co.za/FISIESE-WETENSKAPPE-STUDIEGIDSE-1
  301. Amandajohnson Reference Books
    http://amandajohnson.co.za/REFERENCE-MATERIAL
  302. Amandajohnson Expert Educator Series - Macmillan SA
    http://amandajohnson.co.za/expert-educator-series-macmillan-sa
  303. Amandajohnson Sciences
    http://amandajohnson.co.za/Sciences
  304. Amandajohnson ADHD
    http://amandajohnson.co.za/ADHD
  305. Amandajohnson Ornithology
    http://amandajohnson.co.za/Ornithology
  306. Amandajohnson Social Science / Sosiale Wetenskappe
    http://amandajohnson.co.za/social-science-brsosiale-wetenskap-gr-4-9
  307. Amandajohnson Social Sciences
    http://amandajohnson.co.za/Social-Sciences
  308. Amandajohnson Social Sciences Gr 4
    http://amandajohnson.co.za/social-science-gr-4-textbooks
  309. Amandajohnson Social Sciences Gr 5
    http://amandajohnson.co.za/social-science-grade-5-textbooks
  310. Amandajohnson Social Sciences Gr 6
    http://amandajohnson.co.za/social-science-grade-6-textbooks
  311. Amandajohnson Social Sciences Gr 7
    http://amandajohnson.co.za/social-sciences-gr-7
  312. Amandajohnson Social Sciences Gr 8
    http://amandajohnson.co.za/social-sciences-gr-8
  313. Amandajohnson Social Sciences Gr 9
    http://amandajohnson.co.za/social-sciences-gr-9
  314. Amandajohnson Teachers Guides
    http://amandajohnson.co.za/social-science-teachers-guides
  315. Amandajohnson Sosiale Wetenskappe
    http://amandajohnson.co.za/Sosiale-Wetenskappe
  316. Amandajohnson Sosiale Wetenskappe Graad 4
    http://amandajohnson.co.za/sosiale-wetenskappe-graad-4-boeke
  317. Amandajohnson Sosiale Wetenskappe Graad 5
    http://amandajohnson.co.za/sosiale-wetenskappe-graad-5
  318. Amandajohnson Sosiale Wetenskappe Graad 6
    http://amandajohnson.co.za/sosiale-wetenskappe-graad-6
  319. Amandajohnson Sosiale Wetenskappe Graad 7
    http://amandajohnson.co.za/sosiale-wetenskappe-graad-7
  320. Amandajohnson Sosiale Wetenskappe Graad 8
    http://amandajohnson.co.za/sosiale-wetenskappe-graad-8-boeke
  321. Amandajohnson Sosiale Wetenskappe Graad 9
    http://amandajohnson.co.za/sosiale-wetenskappe-graad-9
  322. Amandajohnson Handleidings
    http://amandajohnson.co.za/sosiale-wetenskappe-onderwysershandleidings
  323. Amandajohnson Study Guides / Studiegidse
    http://amandajohnson.co.za/study-guides-for-all-subjects
  324. Amandajohnson Life Sciences Study Guides
    http://amandajohnson.co.za/Life-Sciences-Study-Guides
  325. Amandajohnson Accounting Study Guides
    http://amandajohnson.co.za/Accounting-Study-Guides-1
  326. Amandajohnson REKENINGKUNDE STUDIEGIDSE
    http://amandajohnson.co.za/REKENINGKUNDE-STUDIEGIDSE-1
  327. Amandajohnson Afrikaans Eerste Additionele Taal (EAT/ FAL) Studiegidse
    http://amandajohnson.co.za/afrikaans-eerste-additionele-taal-eat-fal-studiegidse
  328. Amandajohnson Mathematics Study Guides
    http://amandajohnson.co.za/Mathematics-Study-Guides
  329. Amandajohnson Mathematics Study Guides
    http://amandajohnson.co.za/MEGANIESE-TEGNOLOGIE
  330. Amandajohnson Maths Literacy Study Guides
    http://amandajohnson.co.za/Maths-Literacy-Study-Guides
  331. Amandajohnson Business Studies Study Guides
    http://amandajohnson.co.za/Business-Studies-Study-Guides-1
  332. Amandajohnson Geography Study Guides
    http://amandajohnson.co.za/Geography-Study-Guides
  333. Amandajohnson Physical Sciences Study Guides
    http://amandajohnson.co.za/Physical-Sciences-Study-Guides
  334. Amandajohnson Technology / Tegnologie
    http://amandajohnson.co.za/technology-tegnologie-textbooks
  335. Amandajohnson TECHNOLOGY
    http://amandajohnson.co.za/TECHNOLOGY
  336. Amandajohnson Technology Gr 7
    http://amandajohnson.co.za/technology-grade-7-textbooks
  337. Amandajohnson Technology Gr 8
    http://amandajohnson.co.za/technology-grade-8-textbooks
  338. Amandajohnson Technology Gr 9
    http://amandajohnson.co.za/technology-gr-9
  339. Amandajohnson Civil Technology Gr 10-12
    http://amandajohnson.co.za/civil-technology-textbooks-grade-10-grade-11-and-grade-12
  340. Amandajohnson Electrical Technology Gr 10-12
    http://amandajohnson.co.za/electrical-technology-textbooks-grade-10-grade-11-and-grade-12
  341. Amandajohnson Mechanical Technology Gr 10-12
    http://amandajohnson.co.za/mechanical-technology-textbooks-grade-10-grade-11-and-grade-12
  342. Amandajohnson Teachers Guides
    http://amandajohnson.co.za/technology-teachers-guides
  343. Amandajohnson TEGNOLOGIE
    http://amandajohnson.co.za/TEGNOLOGIE
  344. Amandajohnson Tegnologie Gr 7
    http://amandajohnson.co.za/tegnologie-graad-7
  345. Amandajohnson Tegnologie Gr 8
    http://amandajohnson.co.za/tegnologie-graad-8
  346. Amandajohnson Tegnologie Gr 9
    http://amandajohnson.co.za/tegnologie-graad-9
  347. Amandajohnson Siviele Tegnologie
    http://amandajohnson.co.za/siviele-tegnologie
  348. Amandajohnson Meganiese Tegnologie
    http://amandajohnson.co.za/meganiese-tegnologie
  349. Amandajohnson Elektriese Tegnologie
    http://amandajohnson.co.za/elektriese-tegnologie
  350. Amandajohnson Handleidings
    http://amandajohnson.co.za/tegnologie-onderwysershandleidings
  351. Amandajohnson Tourism / Toerisme Gr 10-12
    http://amandajohnson.co.za/tourism-toerisme-gr-10-12
  352. Amandajohnson TOURISM
    http://amandajohnson.co.za/tourism-textbooks
  353. Amandajohnson TOERISME
    http://amandajohnson.co.za/toerisme-handboeke
  354. Amandajohnson Visual Art / Visuele Kuns Gr 10-12
    http://amandajohnson.co.za/visual-art-visuele-kuns-gr-10-12
  355. Amandajohnson Visual Arts
    http://amandajohnson.co.za/visual-arts-textbooks
  356. Amandajohnson Visuele Kuns
    http://amandajohnson.co.za/visuele-kunste-handboeke
  357. Amandajohnson (0) items
    http://amandajohnson.co.za/cart
  358. Amandajohnson King Edward VII School
    http://amandajohnson.co.za/king-edward-vii-school-textbook-lists-
  359. http://amandajohnson.co.za/king-edward-vii-school-textbook-lists-
    http://amandajohnson.co.za/king-edward-vii-school-textbook-lists-
  360. Amandajohnson Leeuwenhof Akademie
    http://amandajohnson.co.za/leeuwenhof-akademie
  361. http://amandajohnson.co.za/leeuwenhof-akademie
    http://amandajohnson.co.za/leeuwenhof-akademie
  362. Amandajohnson REDDAM HOUSE WATERFALL ESTATE
    http://amandajohnson.co.za/reddam-house-waterfall-estate-college
  363. http://amandajohnson.co.za/reddam-house-waterfall-estate-college
    http://amandajohnson.co.za/reddam-house-waterfall-estate-college
  364. Amandajohnson REDDAM HOUSE BEDFORDVIEW
    http://amandajohnson.co.za/Reddam-House-Bedfordview
  365. http://amandajohnson.co.za/Reddam-House-Bedfordview
    http://amandajohnson.co.za/Reddam-House-Bedfordview
  366. Amandajohnson Saheti School
    http://amandajohnson.co.za/saheti-school-textbook-lists-for-2019
  367. http://amandajohnson.co.za/saheti-school-textbook-lists-for-2019
    http://amandajohnson.co.za/saheti-school-textbook-lists-for-2019
  368. Amandajohnson St Andrews School for Girls
    http://amandajohnson.co.za/St-Andrews-School-for-Girls
  369. http://amandajohnson.co.za/St-Andrews-School-for-Girls
    http://amandajohnson.co.za/St-Andrews-School-for-Girls
  370. Amandajohnson St Benedict's College & Prep School Bedfordview 2021
    http://amandajohnson.co.za/st-benedicts-college-prep-school-bedfordview-2021
  371. http://amandajohnson.co.za/st-benedicts-college-prep-school-bedfordview-2021
    http://amandajohnson.co.za/st-benedicts-college-prep-school-bedfordview-2021
  372. Amandajohnson St Catherines School Germiston
    http://amandajohnson.co.za/St-Catherine-s-School-Germiston
  373. http://amandajohnson.co.za/St-Catherine-s-School-Germiston
    http://amandajohnson.co.za/St-Catherine-s-School-Germiston
  374. Amandajohnson St Martin's High School
    http://amandajohnson.co.za/st-martins-high-school
  375. http://amandajohnson.co.za/st-martins-high-school
    http://amandajohnson.co.za/st-martins-high-school
  376. http://amandajohnson.co.za/Physichem-Science-Self-Study-Gr-10
    http://amandajohnson.co.za/Physichem-Science-Self-Study-Gr-10
  377. Amandajohnson Physichem Science Study Guide Gr 10
    http://amandajohnson.co.za/Physichem-Science-Self-Study-Gr-10
  378. http://amandajohnson.co.za/Physichem-Science-Study-Guide-Gr-11
    http://amandajohnson.co.za/Physichem-Science-Study-Guide-Gr-11
  379. Amandajohnson Physichem Science Study Guide Gr 11
    http://amandajohnson.co.za/Physichem-Science-Study-Guide-Gr-11
  380. http://amandajohnson.co.za/physichem-gr-12-study-guide
    http://amandajohnson.co.za/physichem-gr-12-study-guide
  381. Amandajohnson Physichem Science Study Guide Gr 12
    http://amandajohnson.co.za/physichem-gr-12-study-guide
  382. http://amandajohnson.co.za/asem-visuele-opsomming
    http://amandajohnson.co.za/asem-visuele-opsomming
  383. Amandajohnson Asem Visuele Opsomming
    http://amandajohnson.co.za/asem-visuele-opsomming
  384. http://amandajohnson.co.za/asem-studiegids
    http://amandajohnson.co.za/asem-studiegids
  385. Amandajohnson Asem Werkboek
    http://amandajohnson.co.za/asem-studiegids
  386. http://amandajohnson.co.za/tweede-asem-studiegids
    http://amandajohnson.co.za/tweede-asem-studiegids
  387. Amandajohnson Tweede Asem Studiegids
    http://amandajohnson.co.za/tweede-asem-studiegids
  388. http://amandajohnson.co.za/macrat-dream-house-study-guide
    http://amandajohnson.co.za/macrat-dream-house-study-guide
  389. Amandajohnson Macrat Dream House Study Guide
    http://amandajohnson.co.za/macrat-dream-house-study-guide
  390. http://amandajohnson.co.za/The-Answer-Series-Gr-12-Accounting-2-in-1-CAPS
    http://amandajohnson.co.za/The-Answer-Series-Gr-12-Accounting-2-in-1-CAPS
  391. Amandajohnson The Answer Series Gr 12 Accounting 2-in-1
    http://amandajohnson.co.za/The-Answer-Series-Gr-12-Accounting-2-in-1-CAPS
  392. http://amandajohnson.co.za/The-Answer-Series-GR-12-ACCOUNTING-3-in-1-CAPS
    http://amandajohnson.co.za/The-Answer-Series-GR-12-ACCOUNTING-3-in-1-CAPS
  393. Amandajohnson The Answer Series GR 12 ACCOUNTING 3-in-1
    http://amandajohnson.co.za/The-Answer-Series-GR-12-ACCOUNTING-3-in-1-CAPS
  394. http://amandajohnson.co.za/The-Answer-Series-GR-11-ACCOUNTING-3-in-1-CAPS
    http://amandajohnson.co.za/The-Answer-Series-GR-11-ACCOUNTING-3-in-1-CAPS
  395. Amandajohnson The Answer Series GR 11 ACCOUNTING 3-in-1
    http://amandajohnson.co.za/The-Answer-Series-GR-11-ACCOUNTING-3-in-1-CAPS
  396. http://amandajohnson.co.za/The-Answer-Series-GR-12-Geography-3-in-1-CAPS-
    http://amandajohnson.co.za/The-Answer-Series-GR-12-Geography-3-in-1-CAPS-
  397. Amandajohnson The Answer Series Gr 12 Geography 3-in-1
    http://amandajohnson.co.za/The-Answer-Series-GR-12-Geography-3-in-1-CAPS-
  398. http://amandajohnson.co.za/The-Answer-Series-Gr-11-Life-Sciences-IEB
    http://amandajohnson.co.za/The-Answer-Series-Gr-11-Life-Sciences-IEB
  399. Amandajohnson The Answer Series Gr 11 Life Sciences 3-in-1 IEB
    http://amandajohnson.co.za/The-Answer-Series-Gr-11-Life-Sciences-IEB
  400. http://amandajohnson.co.za/The-Answer-Series-GR-12-PHYSICAL-SCIENCES-3-in-1-CAPS
    http://amandajohnson.co.za/The-Answer-Series-GR-12-PHYSICAL-SCIENCES-3-in-1-CAPS
  401. Amandajohnson The Answer Series Gr 12 PHYSICAL SCIENCES 3-in-1
    http://amandajohnson.co.za/The-Answer-Series-GR-12-PHYSICAL-SCIENCES-3-in-1-CAPS
  402. http://amandajohnson.co.za/mathematics-textbooks-gr-1-to-gr-12
    http://amandajohnson.co.za/mathematics-textbooks-gr-1-to-gr-12
  403. Amandajohnson Shipping & Returns
    http://amandajohnson.co.za/shipping-and-returns-policy
  404. Amandajohnson Privacy Policy
    http://amandajohnson.co.za/privacy-policy
  405. Amandajohnson Terms & Conditions
    http://amandajohnson.co.za/terms-and-conditions
  406. Amandajohnson Contact us
    http://amandajohnson.co.za/contact-us-buy-school-textbooks
  407. Amandajohnson About us
    http://amandajohnson.co.za/aj-co-about-us
  408. Amandajohnson Customer info
    http://amandajohnson.co.za/customer/info
  409. Amandajohnson Addresses
    http://amandajohnson.co.za/customer/addresses
  410. Amandajohnson Orders
    http://amandajohnson.co.za/order/history
  411. Amandajohnson Shopping cart
    http://amandajohnson.co.za/cart
  412. Amandajohnson Wishlist
    http://amandajohnson.co.za/wishlist
  413. Amandajohnson Compare products list
    http://amandajohnson.co.za/compareproducts

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Amandajohnson.co.za

numofslidestoscrollwoordeboeke7fal gr 1back physical sciencesbackwiskundige geletterdheidfal gr 10gr 46grade 11gr 9 teacherskreatiewe kunsstudy guide grekonomie grtechnology grsciences studyfirst additional languagenatuurwetenskappeautoscrolltimeout20900 publishernbspthe answerartswetenskappe graadeconomics grback life sciencesavailable addfalse869 backstudiesgidseeventhospitality studiessciences12 handleidings12 afrikaansgeletterdheid grgr 7 grtotbesigheidstudieslewenswetenskappeguides teacherssciences study guidesgeografiekreatiewe kuns backaccounting grade3in1 rsciences gr 10natural sciences gr3 englishpauseonhoverback mathematics gradedictionariespublishernbspfisichemskillsgeography gradesciences gr 11usgrade 4back physicalstudy guidewetenskappe grdesign ontwerpguides english homeback historyafrikaans fal grwiskunde gradegr 6 natuurwetenskappecreative arts grseries grgrade 7back wiskunde gradeliteraturemathematics studyback naturalsubscribeamp tegnologie gr5study guidesgrade 8gr79 backmapsgr 12 studygr 46 backadd to cartnavigationarrowsscience studyhandleidings mathematicsschool afrikaansskills grlife sciences grgr 7gr 12physical sciences grlewenswetenskappe grstudyhouseems grinformation6 natuurwetenskappe amphandleidingsemshigh school119 teachers guidesnaturallife orientation grhome121012 backgr 13hospitalityshopping cartgrade 12artpublishernbspthesciences backteachers guider 16000 publishernbspfisichemautoscrollmathematics study guidesnatuurwetenskappe ampnatuurwetenskappe gr 7numberofvisibleitemshandleidings mathematics grback economicsamp tegnologieliterature for highback afrikaans huistaalstudiegidsagricultural sciencesgr 8 viewkuns grbesigheidstudies grback natural sciencesstudiesgidse handleidings46studies gasvryheidstudiesviewgraad 12gr 10129true varanswer series grback rekeningkunde10business studies grgr 3gr 1012 backcreative11 life141012natural science amp3in1grade 9school11 accountingorientation gradditional language backsosiale wetenskappe graadscience ampgr 3 englishmenuadditionalenglish hlnavigationdotsenglish homeback life3 afrikaansmathematicssciences grteachers guides englishgradeaccountingtegnologie backanimationspeedvisuele kunsreturnmaths literacy grhl grlewensorienteringstudiesgidse handleidings mathematicslife skills grkreatiewe kuns grdesignorientationconsumer studieslewensvaardighedeconsumerliteracyguidesstudies grasemmathematics gradetot grkreatiewepublishernbspthe answer adddramatic artsdictionaries englishdefaultfisiese wetenskappe grstliteracy grlanguage gr3gr 5afrikaans falhighback natuurwetenskappegr 9 back12 studypublishernbspfisichem addfalfal gr4 gr 6visueletoerismeback businessslideranswer seriesafrikaans huistaalekonomie16000 publishernbspfisichem add11 life sciencesrekenaarstudies9 teachersebwphysicalenglish hl grgr 11 lifeloopitemsisizulu9 back naturalback geographyhandleidings studiesgidsesocial sciences4technology gr 1012landbouwetenskapper 20900responsivebreakpointsobjisettingsslidestoshowwetenskappe backstudy guides teachersfal teachershome languageguides english9 englishback technologyprimary schoolshopping8 viewenglishview alllanguagesciences gr 88 amp8 amp grrback creative3in1 r 20900back creative artsback natural scienceeconomicsmathematics wiskundegr 12 afrikaansfirst additionalwiskundeafrikaansback mathematicssocial46 backstudy guides backgr 1natuurwetenskappe amp tegnologier 20900 publishernbsptheseries gr 12back business studiesback englishback agricultural sciences1 to grleesgr 79 backback socialafrikaans huistaal gr7 to granswer addback accountinghospitality studies gasvryheidstudiesresponsivebreakpointsobjarts grnatural sciencegr 9 handleidingssciences gr 7lees afrikaansstudiesgr 49 afrikaansprice79geografie backsosialegr 10grade 6readersgrade 10teachersfirsthistorytegnologieamp technologyafrikaans readersgr 9 afrikaanstechnology16000 publishernbspfisichemvarwetenskappesciences gr 12fisiesefal studycartlanguage backwiskundigeamp grgasvryheidstudiesback agricultural7 gr 8publishernbspthe answer2guidegeografie graad12 study guides10 to grresponsive8 view alllifeanswertechnology backscience amp technologyscienceenglish first9 handleidingssocial sciences grgrade 5maths1back english falgr 12 studiegidseekonomie back1 1physical sciencesseriessciences gr 9gr 8 ampdramatic6 afrikaanshuistaal gr 7rekeningkunde backgeographysosiale wetenskappefal gr 4studiegidse handleidingsback afrikaanslife sciencesgr 12 handleidingssosiale wetenskappe backgeskiedenis backresourcesenglish literaturenatuurwetenskappe graddbusinessback social sciences20900 publishernbspthegr 9rekeningkunde12 handleidings studiesgidseamp gr 9tourism toerismegr 11geskiedeniskuns4 grhuistaalhlebw grtruegrade 12 studylife skills12 studiegidsetypetegnologie grbreakgeletterdheid7 grgr 8guide grenglish falontwerpfisiese wetenskappe backguides teachers guidesgr 4 gramplewensorientering backprimaryisrtlrekeningkunde graadgraad 10huistaal grstudy guides englishgr 79r 16000business studiesphysichem sciencelife orientationallgeletterdheid backscience study guidecreative artsifhistory grgraad 11geskiedenis grvisualtourismfal study guideskuns backavailablemathematics grguides backgr 9 englishgr 6 afrikaanscart the answerback wiskundegr 210 gr13english fal grlewensvaardighede gr12 studiegidse handleidingswiskunde gr6 natuurwetenskappecaseadditional languagephysichem science studygr 6wiskundige geletterdheid grphysichemgr 3 afrikaansstayworkbooksfalse var0english first additionalamp technology grteachers guidesmaths literacygraadagriculturalfisiese wetenskappestudiegidsenatural sciences

Longtail Keyword Density for Amandajohnson.co.za

KeywordsOccurences
12 study guides18
study guides teachers18
guides teachers guides16
afrikaans huistaal gr14
add to cart13
life skills gr12
gr 12 study12
social sciences gr12
sosiale wetenskappe graad12
natuurwetenskappe amp tegnologie10
natural sciences gr8
9 teachers guides8
afrikaans fal gr8
gr 9 teachers8
natural science amp8
gr 10-12 back8
12 studiegidse handleidings8
science amp technology8
amp technology gr6
english hl gr6
gr 9 handleidings6
english fal gr6
sciences gr 76
wiskundige geletterdheid gr6
natuurwetenskappe gr 76
gr 7 gr6
gr 12 handleidings6
back life sciences6
handleidings mathematics gr6
back wiskunde grade6
life sciences gr6
amp tegnologie gr6
grade 12 study6
kreatiewe kuns gr6
maths literacy gr6
fisiese wetenskappe gr6
publishernbspthe answer add6
20900 publishernbspthe answer6
r 20900 publishernbspthe6
gr 9 back6
answer series gr6
cart the answer6
first additional language6
technology gr 10-126
1 to gr6
creative arts gr6
sciences study guides6
back mathematics grade6
business studies gr6
gr 12 studiegidse6
physical sciences gr6
8 amp gr4
fisiese wetenskappe back4
sciences gr 94
back natural science4
sciences gr 84
series gr 124
back physical sciences4
amp gr 94
gr 6 natuurwetenskappe4
gr 8 amp4
back natural sciences4
7 gr 84
6 natuurwetenskappe amp4
mathematics study guides4
study guides back4
back social sciences4
9 back natural4
sosiale wetenskappe back4
3-in-1 r 209004
gr 7-9 back4
fal gr 44
kreatiewe kuns back4
back business studies4
back agricultural sciences4
fal study guides4
10 to gr4
fal gr 104
7 to gr4
fal gr 14
literature for high4
additional language back4
gr 12 afrikaans4
gr 9 afrikaans4
huistaal gr 74
gr 6 afrikaans4
gr 3 afrikaans4
back afrikaans huistaal4
gr 4-6 back4
back creative arts4
english first additional4
hospitality studies gasvryheidstudies4
life orientation gr4
gr 8 view4
8 view all4
studiesgidse handleidings mathematics4
back english fal4
sciences gr 104
12 handleidings studiesgidse4
sciences gr 124
guides english home4
study guides english4
teachers guides english4
gr 9 english4
4 gr 64
gr 4 gr4
gr 3 english4
sciences gr 114
physichem science study3
gr 11 life3
16000 publishernbspfisichem add3
r 16000 publishernbspfisichem3
study guide gr3
science study guide3
11 life sciences3
study guides50
gr 1239
gr 738
gr 1033
teachers guides32
gr 932
sciences gr32
gr 1129
gr 828
gr 420
guides teachers18
technology gr18
gr 618
afrikaans huistaal18
wiskunde grade18
mathematics grade18
12 study18
lewensvaardighede gr16
sosiale wetenskappe16
gr 10-1214
gr 314
fal gr14
social sciences14
huistaal gr14
gr 114
life sciences13
wetenskappe graad12
business studies12
afrikaans fal12
tegnologie gr12
english fal12
natural sciences12
life skills12
skills gr12
physical sciences11
fisiese wetenskappe10
natuurwetenskappe gr10
kreatiewe kuns10
amp tegnologie10
natuurwetenskappe amp10
back life10
sciences back10
maths literacy10
gr 510
back english10
9 teachers10
amp technology8
creative arts8
studiegidse handleidings8
guides english8
science amp8
natural science8
back natural8
english literature8
12 studiegidse8
wiskundige geletterdheid8
tot gr8
wetenskappe back8
kuns gr8
life orientation8
9 handleidings8
back wiskunde8
mathematics gr8
grade 128
teachers guide8
back mathematics8
grade 118
grade 108
9 back8
10-12 back8
wiskunde gr8
high school7
handleidings mathematics6
accounting grade6
geografie graad6
geskiedenis gr6
geography grade6
publishernbspthe answer6
geletterdheid gr6
12 handleidings6
rekeningkunde graad6
series gr6
r 209006
20900 publishernbspthe6
literacy gr6
7 gr6
lewenswetenskappe gr6
answer add6
history gr6
english hl6
hl gr6
ekonomie gr6
wetenskappe gr6
studies gr6
true var6
arts gr6
sciences study6
first additional6
back afrikaans6
besigheidstudies gr6
economics gr6
ems gr6
ebw gr6
false var6
agricultural sciences6
primary school6
tegnologie back6
answer series6
additional language6
7-9 back4
gr 7-94
back technology4
back social4
grade 64
tourism toerisme4
grade 74
back physical4
grade 84
grade 94
gr 1-34
visuele kuns4
technology back4
geletterdheid back4
grade 54
amp gr4
8 amp4
back natuurwetenskappe4
study guide4
6 natuurwetenskappe4
mathematics study4
guides back4
rekeningkunde back4
grade 44
language back4
dictionaries english4
design ontwerp4
4-6 back4
kuns back4
consumer studies4
10 gr4
back business4
back agricultural4
fal teachers4
fal study4
12 afrikaans4
ekonomie back4
9 afrikaans4
6 afrikaans4
3 afrikaans4
school afrikaans4
afrikaans readers4
lees afrikaans4
graad 124
graad 114
graad 104
back rekeningkunde4
dramatic arts4
back creative4
back economics4
handleidings studiesgidse4
gr 4-64
studiesgidse handleidings4
view all4
8 view4
orientation gr4
gr 24
home language4
studies gasvryheidstudies4
hospitality studies4
lewensorientering back4
back accounting4
9 english4
english first4
3 english4
4 gr4
language gr4
back history4
3-in-1 r4
english home4
geografie back4
back geography4
geskiedenis back4
1 13
physichem science3
science study3
r 160003
16000 publishernbspfisichem3
publishernbspfisichem add3
available add3
shopping cart3
11 life3
mathematics wiskunde3
11 accounting3
guide gr3
gr305
back158
guides82
sciences60
study54
051
english48
grade48
147
afrikaans46
244
341
teachers40
440
amp35
534
handleidings34
life33
mathematics33
var32
wiskunde31
629
fal28
728
studies26
technology26
tegnologie26
wetenskappe26
graad24
823
school21
natural20
huistaal20
natuurwetenskappe20
studiegidse18
social16
lewensvaardighede16
916
1016
sosiale16
cart16
science15
accounting15
kuns14
arts14
10-1214
geography13
r13
add13
physical13
literacy12
answer12
skills12
guide12
business12
rekeningkunde12
dictionaries12
fisiese10
history10
1110
geskiedenis10
geletterdheid10
maths10
geografie10
literature10
animationspeed10
false10
besigheidstudies10
ekonomie10
economics10
creative10
kreatiewe10
language10
home9
true8
wiskundige8
tot8
series8
ebw8
orientation8
studiesgidse8
if8
ems8
hl8
lewenswetenskappe8
high7
autoscrolltimeout6
additional6
first6
agricultural6
primary6
landbouwetenskappe6
126
pauseonhover6
responsivebreakpointsobj6
numofslidestoscroll6
publishernbspthe6
isizulu6
design6
ontwerp6
dramatic6
art6
visuele5
case5
3-in-15
all5
1-34
navigationdots4
isrtl4
workbooks4
readers4
autoscroll4
navigationarrows4
lees4
numberofvisibleitems4
7-94
break4
resources4
responsivebreakpointsobjisettingsslidestoshow4
slider4
responsive4
maps4
rekenaarstudies4
loopitems4
lewensorientering4
tourism4
toerisme4
visual4
4-64
view4
134
gasvryheidstudies4
hospitality4
woordeboeke4
consumer4
st4
subscribe3
available3
asem3
publishernbspfisichem3
143
stay3
physichem3
house3
type3
return3
price3
shopping3
default3
event3
menu3
studiegids3
information3
us3

Who hosts Amandajohnson.co.za?

Amandajohnson.co.za Hosting Provider Information

Hosted IP Address:196.46.184.182
Hosted Hostname:196-46-184-182.aitonline.co.za
Service Provider:ABOUTIT-ONLINE
Hosted Country:South AfricaZA
Location Latitude:-25.757
Location Longitude:28.1443
Webserver Software:Microsoft-IIS/8.5

Is "ABOUTIT-ONLINE" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
ABOUTIT-ONLINE
0.0007%

HTTP Header Analysis for Amandajohnson.co.za

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/8.5
Date: Thu, 22 Oct 2020 09:56:17 GMT
Content-Length: 245783

Amandajohnson.co.za Domain Nameserver Information

HostIP AddressCountry
ns1.host-h.net 129.232.248.30
ns2.host-h.net 129.232.248.40
ns1.dns-h.com 129.232.248.30


Need to find out who hosts Amandajohnson.co.za?


Domain Registration (WhoIs) information for Amandajohnson.co.za

 simple CO.ZA whois server
The CO.ZA simple whois server
© Copyright ZACR 1995-2020
Use of this facility subject to theterms of site usage
Your query has generated the following reply:-

Search on amandajohnson (.co.za)
Match: One

Domain: amandajohnson.co.za

Accounting info....
Date |Type| Cost |Invoices are E-Mail to....|Paid Date |ICnt| TrkNo |Billing Info

Flashing RED indicates that payment has not been received - please
confirm with the ZACR accounting department, Login to show email
should this
not be according to your records. You have been sent 0 invoices/statements.

0a. lastupdate :
0b. emailsource : REDACTED
0c. emailposted :
0d. emailsubject :
0g. historycount :
0h. invoiceno :
0i. contracttype :
0j. rcsversion :
1a. domain : amandajohnson.co.za
1b. action :
1c. Registrar : xneelo (Pty) Ltd
2a. registrant : REDACTED
2b. registrantpostaladdress: REDACTED
2c. registrantstreetaddress: REDACTED
2d. amount : REDACTED
2e. paymenttype : REDACTED
2f. billingaccount : REDACTED
2g. billingemail : REDACTED
2i. invoiceaddress : REDACTED
2j. registrantphone : REDACTED
2k. registrantfax : REDACTED
2l. registrantemail : REDACTED
2n. vat : REDACTED
3b. cname :
3c. cnamesub1 :
3d. cnamesub2 :
3e. creationdate : 2012/05/23 16:11:36
4a. admin : REDACTED
4b. admintitle : REDACTED
4c. admincompany : REDACTED
4d. adminpostaladdr : REDACTED
4e. adminphone : REDACTED
4f. adminfax : REDACTED
4g. adminemail : REDACTED
4h. adminnic : REDACTED
5a. tec : REDACTED
5b. tectitle : REDACTED
5c. teccompany : REDACTED
5d. tecpostaladdr : REDACTED
5e. tecphone : REDACTED
5f. tecfax : REDACTED
5g. tecemail : REDACTED
5h. tecnic : REDACTED
6a. primnsfqdn : ns1.host-h.net
6b. primnsip :
6c. primnsipv6 :
6e. secns1fqdn : ns2.host-h.net
6f. secns1ip :
6g. secns1ipv6 :
6i. secns2fqdn : ns1.dns-h.com
6j. secns2ip :
6k. secns2ipv6 :
6m. secns3fqdn :
6n. secns3ip :
6o. secns3ipv6 :
6q. secns4fqdn :
6r. secns4ip :
6s. secns4ipv6 :
8a. netblock1start :
8b. netblock1end :
8c. netblock2start :
8d. netblock2end :
8e. netblock3start :
8f. netblock3end :
9a. description1 :
9b. description2 :
9c. description3 :
9d. description4 :
9e. description5 :
9f. description6 :

Next Query - Domain name
.co.za
Please refer to the CO.ZA contact details should you have any problems

Websites with Similar Names

Amand-a.com
amand-a.com -&nbspamand a Resources and Information.
Amand-in.com
amand-in
Amanda-almqvistart.com
amanda-almqvistart.com has expired
Amanda-ames.info
Amanda Ames
Amanda-and-alex.us
Amanda Bossi and Alex Hurst's Wedding Website
Amanda-and-christopher.com
Amanda Burgess and Christopher Jordan's Wedding Website
Amanda-and-darryle.com
502 Bad Gateway
Amanda-and-eric.com
Amanda & Eric — Minted
Amanda-and-kedar.com
Amanda + Kedar

Recently Updated Websites

9hao5.com (2 seconds ago.)Arcticrisk.com (2 seconds ago.)Annelltd.com (4 seconds ago.)Cedarhillstatepark.org (4 seconds ago.)Carrycreations.com (6 seconds ago.)Antalyasuboregi.com (8 seconds ago.)Alegoriacultural.com (9 seconds ago.)Chancejan.com (12 seconds ago.)Certifiedserviceshop.com (14 seconds ago.)Abbottconferenceservices.com (14 seconds ago.)Bladeliving.com (16 seconds ago.)Celebratenewcastle.com (16 seconds ago.)Dellwoodinvestmentsnc.com (16 seconds ago.)Andysoria.com (18 seconds ago.)Angstrom-consultants.com (19 seconds ago.)Aqualitalia.com (20 seconds ago.)Arnopia.com (22 seconds ago.)Boycottnikelogo.com (23 seconds ago.)Fill-rx-plus.com (23 seconds ago.)Alphadise.com (24 seconds ago.)645hurlingameave.com (26 seconds ago.)Deyeqs.com (26 seconds ago.)Appleseedflorist.com (27 seconds ago.)Americanlocksnkey.com (30 seconds ago.)Anderseana.com (32 seconds ago.)Auditzar.com (33 seconds ago.)Chicagopinotfest.com (33 seconds ago.)2mza-avocats.com (35 seconds ago.)Billchampion.com (35 seconds ago.)6jrs7.com (36 seconds ago.)

Recently Searched Keywords

press room (5 seconds ago.)free trial (6 seconds ago.)jquery (8 seconds ago.)collars (8 seconds ago.)dishwasher (9 seconds ago.)dodaj (13 seconds ago.)lookup (14 seconds ago.)1460 broadway (14 seconds ago.)1460 broadway (15 seconds ago.)1460 broadway (16 seconds ago.)1460 broadway (18 seconds ago.)1460 broadway (20 seconds ago.)paid (24 seconds ago.)1460 broadway (26 seconds ago.)super (27 seconds ago.)loop true (29 seconds ago.)youtube更新しました!「背中だけがデカいマサの背中トレーニング」 (30 seconds ago.)madureira shopping (33 seconds ago.)isstackedbreakpoint (39 seconds ago.)silvia assessoria (42 seconds ago.)xd-10086 (43 seconds ago.)wife swapping meat market (43 seconds ago.)wife admits cheating sex (43 seconds ago.)spa home delivery (44 seconds ago.)skdjf (45 seconds ago.)serenitybeaches (45 seconds ago.)2018-0503 (47 seconds ago.)spa home service (47 seconds ago.)unconscious drunk wife fucked hard (47 seconds ago.)1460 (48 seconds ago.)