High trust score |
Amazon.co.jp Website Information
Amazon.co.jp has a High trust score, a Statvoo Rank of A, an Alexa Rank of 41, a Majestic Rank of 512, a Domain Authority of 93% and is listed in DMOZ.
Amazon.co.jp is hosted by Amazon.com, Inc. in Oregon, Portland, United States, 97086.
Amazon.co.jp has an IP Address of 54.240.252.0 and a hostname of 54.240.252.0 and runs Server web server.
The domain amazon.co.jp was registered 1 decade 6 years 10 months ago by , it was last modified 4 years 10 months 1 week ago and currently is set to expire 201 decades 9 years 5 days ago.
Whois information for amazon.co.jp
Full Whois Lookup for Amazon.co.jp Whois Lookup
[ JPRS database provides information on network administration. Its use is ]
[ restricted to network administration purposes. For further information, ]
[ use 'whois -h whois.jprs.jp help'. To suppress Japanese output, add'/e' ]
[ at the end of command, e.g. 'whois -h whois.jprs.jp xxx/e'. ]
Domain Information:
a. [Domain Name] AMAZON.CO.JP
g. [Organization] Amazon, Inc.
l. [Organization Type] Foreign Company
m. [Administrative Contact] JC076JP
n. [Technical Contact] IK4644JP
p. [Name Server] ns1.p31.dynect.net
p. [Name Server] ns2.p31.dynect.net
p. [Name Server] pdns1.ultradns.net
p. [Name Server] pdns6.ultradns.co.uk
s. [Signing Key]
[State] Connected (2017/11/30)
[Registered Date] 2002/11/21
[Connected Date] 2002/11/21
[Last Update] 2016/12/01 01:03:39 (JST)
[ JPRS database provides information on network administration. Its use is ]
[ restricted to network administration purposes. For further information, ]
[ use 'whois -h whois.jprs.jp help'. To suppress Japanese output, add'/e' ]
[ at the end of command, e.g. 'whois -h whois.jprs.jp xxx/e'. ]
Contact Information:
a. [JPNIC Handle] JC076JP
c. [Last, First] Cheung, Jasper
d. [E-Mail] Login to show email
[Organization] Amazon, Inc.
l. [Division]
n. [Title] Representative in Japan
o. [TEL]
p. [FAX]
y. [Reply Mail] Login to show email
Update] 2015/08/12 19:29:39 Login to show email
JPRS database provides information on network administration. Its use is ]
[ restricted to network administration purposes. For further information, ]
[ use 'whois -h whois.jprs.jp help'. To suppress Japanese output, add'/e' ]
[ at the end of command, e.g. 'whois -h whois.jprs.jp xxx/e'. ]
Contact Information:
a. [JPNIC Handle] IK4644JP
c. [Last, First] Kono, Isao
d. [E-Mail] Login to show email
[Organization] Amazon, Inc.
l. [Division] Corporate Services
n. [Title] JP Corporate Services Manager
o. [TEL] 011-330-3026
p. [FAX] 011-330-3002
y. [Reply Mail] Login to show email
Update] 2015/08/12 19:27:23 Login to show email
Who hosts Amazon.co.jp?
Amazon.co.jp Web Server Information
| Hosted IP Address: | 54.240.252.0 |
| Hosted Hostname: | 54.240.252.0 |
| Service Provider: | Amazon.com, Inc. |
| Hosted Country: |  US |
| Location Latitude: | 45.5234 |
| Location Longitude: | -122.676 |
| Webserver Software: | Server |
HTTP Header Analysis for Amazon.co.jp
| Http-Version: | 1.1 |
| Status-Code: | 503 |
| Status: | 503 Service Unavailable |
| Date: | Fri, 22 May 2015 15:05:37 GMT |
| Server: | Server |
| Last-Modified: | Tue, 21 Oct 2014 19:50:16 GMT |
| ETag: | "8a7-505f423e62e00-gzip" |
| Accept-Ranges: | bytes |
| Vary: | Accept-Encoding,User-Agent |
| Content-Encoding: | gzip |
| Content-Length: | 1102 |
| Cneonction: | close |
| Content-Type: | text/html |
Need to find out who hosts Amazon.co.jp?
Amazon.co.jp Free SEO Report
Website Inpage Analysis for Amazon.co.jp
| H1 Headings: | 0 | ||
| H2 Headings: | 0 | ||
| H3 Headings: | 0 | ||
| H4 Headings: | 0 | ||
| H5 Headings: | 0 | ||
| H6 Headings: | 0 | ||
| Total IFRAMEs: | 0 | ||
| Total Images: | 0 | ||
| Google Adsense: | Not Applicable | ||
| Google Analytics: | Not Applicable |
Keyword Cloud for Amazon.co.jp
1nowifwindowgwi windowgwibillboardwidgetdauexlduex function uexldelsedatebeginwindownavmettmp windownavmettmpnew14pxiffunction uexldwb 1newfunction2pxdatebeginwindownavmettmp windownavmettmpnew datelineheight 14pxifwindowgwi windowgwibillboardwidget newlineheightwrapperselectoritemstextamazontypeofuexldwindowgwibillboardwidget newwindownavbardeclareonloadfontfamily arialsansserifdate0pxwindownavmettmpnew date0varwindowgwibillboardwidgetuexnbsp nbsp nbspifwindowgwiwbnavbarnavprimedayuex functionnbsp2fontfamilywindownavfalsenbsp nbspamazoncallbackdelimiterreturnarialsansserifdatebeginwindownavmettmpelse ifdrivewindownavmettmpnewgatewaynavsitewidemsgdesktop
Longtail Keyword Density for Amazon.co.jp
| Keywords | Occurences |
|---|---|
| datebeginwindownavmettmp windownavmettmpnew date | 6 |
| ifwindowgwi windowgwibillboardwidget new | 3 |
| nbsp nbsp nbsp | 3 |
| uex function uexld | 3 |
| windownavmettmpnew date | 9 |
| datebeginwindownavmettmp windownavmettmpnew | 8 |
| nbsp nbsp | 4 |
| ifwindowgwi windowgwibillboardwidget | 3 |
| windowgwibillboardwidget new | 3 |
| font-family arialsans-serif | 3 |
| line-height 14px | 3 |
| function uexld | 3 |
| wb 1 | 3 |
| else if | 3 |
| uex function | 3 |
| function | 16 |
| amazon | 14 |
| var | 13 |
| if | 12 |
| date | 12 |
| windownavmettmpnew | 11 |
| datebeginwindownavmettmp | 11 |
| 0 | 9 |
| windownav | 9 |
| nbsp | 6 |
| new | 5 |
| else | 5 |
| return | 5 |
| 1 | 4 |
| delimiter | 4 |
| line-height | 4 |
| windownavbardeclareonload | 4 |
| typeof | 4 |
| dauexld | 4 |
| font-family | 4 |
| false | 4 |
| itemstextamazon | 3 |
| drive | 3 |
| arialsans-serif | 3 |
| wrapperselector | 3 |
| windowgwibillboardwidget | 3 |
| 0px | 3 |
| callback | 3 |
| 2px | 3 |
| now | 3 |
| wb | 3 |
| uexld | 3 |
| uex | 3 |
| navbarnav-primeday | 3 |
| 2 | 3 |
| gatewaynav-sitewide-msgdesktop | 3 |
| 14px | 3 |
| ifwindowgwi | 3 |
What are the nameservers for amazon.co.jp?
Amazon.co.jp Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns1.p31.dynect.net |  | 208.78.70.31 | United States |
| ns2.p31.dynect.net | | 204.13.250.31 | United States |
| pdns1.ultradns.net | | 204.74.108.1 | United States |
| pdns6.ultradns.co.uk | | 204.74.115.1 | United States |