Amazon.co.jp  |  ?????????°??????
High trust score  | 

Amazon.co.jp Website Information

Amazon.co.jp has a High trust score, a Statvoo Rank of A, an Alexa Rank of 41, a Majestic Rank of 512, a Domain Authority of 93% and is listed in DMOZ.

Amazon.co.jp is hosted by Amazon.com, Inc. in Oregon, Portland, United States, 97086.
Amazon.co.jp has an IP Address of 54.240.252.0 and a hostname of 54.240.252.0 and runs Server web server.

The domain amazon.co.jp was registered 1 decade 6 years 10 months ago by , it was last modified 4 years 10 months 1 week ago and currently is set to expire 201 decades 9 years 5 days ago.


Whois information for amazon.co.jp

Full Whois Lookup for Amazon.co.jp Whois Lookup

[ JPRS database provides information on network administration. Its use is ]
[ restricted to network administration purposes. For further information, ]
[ use 'whois -h whois.jprs.jp help'. To suppress Japanese output, add'/e' ]
[ at the end of command, e.g. 'whois -h whois.jprs.jp xxx/e'. ]

Domain Information:
a. [Domain Name] AMAZON.CO.JP
g. [Organization] Amazon, Inc.
l. [Organization Type] Foreign Company
m. [Administrative Contact] JC076JP
n. [Technical Contact] IK4644JP
p. [Name Server] ns1.p31.dynect.net
p. [Name Server] ns2.p31.dynect.net
p. [Name Server] pdns1.ultradns.net
p. [Name Server] pdns6.ultradns.co.uk
s. [Signing Key]
[State] Connected (2017/11/30)
[Registered Date] 2002/11/21
[Connected Date] 2002/11/21
[Last Update] 2016/12/01 01:03:39 (JST)

[ JPRS database provides information on network administration. Its use is ]
[ restricted to network administration purposes. For further information, ]
[ use 'whois -h whois.jprs.jp help'. To suppress Japanese output, add'/e' ]
[ at the end of command, e.g. 'whois -h whois.jprs.jp xxx/e'. ]

Contact Information:
a. [JPNIC Handle] JC076JP
c. [Last, First] Cheung, Jasper
d. [E-Mail] Login to show email
[Organization] Amazon, Inc.
l. [Division]
n. [Title] Representative in Japan
o. [TEL]
p. [FAX]
y. [Reply Mail] Login to show email
Update] 2015/08/12 19:29:39 Login to show email
JPRS database provides information on network administration. Its use is ]
[ restricted to network administration purposes. For further information, ]
[ use 'whois -h whois.jprs.jp help'. To suppress Japanese output, add'/e' ]
[ at the end of command, e.g. 'whois -h whois.jprs.jp xxx/e'. ]

Contact Information:
a. [JPNIC Handle] IK4644JP
c. [Last, First] Kono, Isao
d. [E-Mail] Login to show email
[Organization] Amazon, Inc.
l. [Division] Corporate Services
n. [Title] JP Corporate Services Manager
o. [TEL] 011-330-3026
p. [FAX] 011-330-3002
y. [Reply Mail] Login to show email
Update] 2015/08/12 19:27:23 Login to show email

Who hosts Amazon.co.jp?

Amazon.co.jp Web Server Information

Hosted IP Address:54.240.252.0
Hosted Hostname:54.240.252.0
Service Provider:Amazon.com, Inc.
Hosted Country:United StatesUS
Location Latitude:45.5234
Location Longitude:-122.676
Webserver Software:Server

HTTP Header Analysis for Amazon.co.jp

Http-Version: 1.1
Status-Code: 503
Status: 503 Service Unavailable
Date: Fri, 22 May 2015 15:05:37 GMT
Server: Server
Last-Modified: Tue, 21 Oct 2014 19:50:16 GMT
ETag: "8a7-505f423e62e00-gzip"
Accept-Ranges: bytes
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 1102
Cneonction: close
Content-Type: text/html


Need to find out who hosts Amazon.co.jp?

Amazon.co.jp Free SEO Report

Website Inpage Analysis for Amazon.co.jp

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Amazon.co.jp

1nowifwindowgwi windowgwibillboardwidgetdauexlduex function uexldelsedatebeginwindownavmettmp windownavmettmpnew14pxiffunction uexldwb 1newfunction2pxdatebeginwindownavmettmp windownavmettmpnew datelineheight 14pxifwindowgwi windowgwibillboardwidget newlineheightwrapperselectoritemstextamazontypeofuexldwindowgwibillboardwidget newwindownavbardeclareonloadfontfamily arialsansserifdate0pxwindownavmettmpnew date0varwindowgwibillboardwidgetuexnbsp nbsp nbspifwindowgwiwbnavbarnavprimedayuex functionnbsp2fontfamilywindownavfalsenbsp nbspamazoncallbackdelimiterreturnarialsansserifdatebeginwindownavmettmpelse ifdrivewindownavmettmpnewgatewaynavsitewidemsgdesktop

Longtail Keyword Density for Amazon.co.jp

KeywordsOccurences
datebeginwindownavmettmp windownavmettmpnew date6
ifwindowgwi windowgwibillboardwidget new3
nbsp nbsp nbsp3
uex function uexld3
windownavmettmpnew date9
datebeginwindownavmettmp windownavmettmpnew8
nbsp nbsp4
ifwindowgwi windowgwibillboardwidget3
windowgwibillboardwidget new3
font-family arialsans-serif3
line-height 14px3
function uexld3
wb 13
else if3
uex function3
function16
amazon14
var13
if12
date12
windownavmettmpnew11
datebeginwindownavmettmp11
09
windownav9
nbsp6
new5
else5
return5
14
delimiter4
line-height4
windownavbardeclareonload4
typeof4
dauexld4
font-family4
false4
itemstextamazon3
drive3
arialsans-serif3
wrapperselector3
windowgwibillboardwidget3
0px3
callback3
2px3
now3
wb3
uexld3
uex3
navbarnav-primeday3
23
gatewaynav-sitewide-msgdesktop3
14px3
ifwindowgwi3

What are the nameservers for amazon.co.jp?

Amazon.co.jp Domain Nameserver Information

HostIP AddressCountry
ns1.p31.dynect.net 208.78.70.31United States United States
ns2.p31.dynect.net 204.13.250.31United States United States
pdns1.ultradns.net 204.74.108.1United States United States
pdns6.ultradns.co.uk 204.74.115.1United States United States

Amazon.co.jp Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Amazon.co.jp is a scam?