|  ?????????°?????? Website Information was registered 1 decade 5 years ago. It is the world's 41st most popular site among over 300 million websites. It is a domain with an extension and is hosted by, Inc.. This site has a Google PageRank of 8/10.
It has an estimated worth of $ 292,907,880.00 and has an average daily income of approximately $ 271,211.00. This website is also listed on Dmoz which significantly helps it's overall ranking. is SAFE to browse as we did not find any active threats.

Registration Date:
Domain Registrar:
Service Provider:, Inc.  United States
High trust score
Late Updated:
2 years 6 months ago

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:A
Alexa Rank Alexa Rank:41
Majestic Rank Majestic Rank:512
PageSpeed Google PageSpeed:75%
Domain Authority Domain Authority:93%
DMOZ DMOZ Listing:Yes

Social Engagement for

Facebook Shared:0
Facebook Like Count:0
Facebook Comment Count:0
Twitter Tweets:20,225,720
LinkedIn Shares:0
Google Plus Shares:41,518 Traffic Report

Daily Unique Visitors:33,901,427
Daily Pageviews:271,211,416 Estimated Valuation

Income Per Day:$ 271,211.00
Estimated Worth:$ 292,907,880.00

Search Engine Indexes for

Google Indexed Pages:View Google pages
Yahoo Indexed Pages:View Yahoo pages
Bing Indexed Pages:View Bing pages
History:View WayBackMachine history

Search Engine Backlinks for

Google Backlinks:0
Bing Backlinks:0
Alexa BackLinks:109,864

Safety Information for

Google Safe Browsing:No Risk Issues
Siteadvisor Rating:No Risk Issues
WOT Trustworthiness: Very Poor
WOT Privacy: Very Poor
WOT Child Safety: Very Poor

Similarly Ranked Websites to

39 Google

40 ?

41 ?????????°??????

42 / Twitter

43 Google permite acceder a la información mundial en castellano, catalán, gallego, euskara e inglés.

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

[ JPRS database provides information on network administration. Its use is ]
[ restricted to network administration purposes. For further information, ]
[ use 'whois -h help'. To suppress Japanese output, add'/e' ]
[ at the end of command, e.g. 'whois -h xxx/e'. ]

Domain Information:
a. [Domain Name] AMAZON.CO.JP
g. [Organization] Amazon, Inc.
l. [Organization Type] Foreign Company
m. [Administrative Contact] JC076JP
n. [Technical Contact] IK4644JP
p. [Name Server]
p. [Name Server]
p. [Name Server]
p. [Name Server]
s. [Signing Key]
[State] Connected (2017/11/30)
[Registered Date] 2002/11/21
[Connected Date] 2002/11/21
[Last Update] 2016/12/01 01:03:39 (JST)

[ JPRS database provides information on network administration. Its use is ]
[ restricted to network administration purposes. For further information, ]
[ use 'whois -h help'. To suppress Japanese output, add'/e' ]
[ at the end of command, e.g. 'whois -h xxx/e'. ]

Contact Information:
a. [JPNIC Handle] JC076JP
c. [Last, First] Cheung, Jasper
d. [E-Mail] Login to show email
[Organization] Amazon, Inc.
l. [Division]
n. [Title] Representative in Japan
o. [TEL]
p. [FAX]
y. [Reply Mail] Login to show email
Update] 2015/08/12 19:29:39 Login to show email
JPRS database provides information on network administration. Its use is ]
[ restricted to network administration purposes. For further information, ]
[ use 'whois -h help'. To suppress Japanese output, add'/e' ]
[ at the end of command, e.g. 'whois -h xxx/e'. ]

Contact Information:
a. [JPNIC Handle] IK4644JP
c. [Last, First] Kono, Isao
d. [E-Mail] Login to show email
[Organization] Amazon, Inc.
l. [Division] Corporate Services
n. [Title] JP Corporate Services Manager
o. [TEL] 011-330-3026
p. [FAX] 011-330-3002
y. [Reply Mail] Login to show email
Update] 2015/08/12 19:27:23 Login to show email

Who hosts is hosted by, Inc. in Oregon, Portland, United States, 97086. has an IP Address of and a hostname of and runs Server web server. Web Server Information

Hosted IP Address:
Hosted Hostname:
Service, Inc.
Hosted Country:United StatesUS
Location Latitude:45.5234
Location Longitude:-122.676
Webserver Software:Server
Google Map of 50,12

Websites Hosted on Same IP (i.e. | ?? - ???????????????????????


  757,030   $ 1,200.00

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 503
Status: 503 Service Unavailable
Date: Fri, 22 May 2015 15:05:37 GMT
Server: Server
Last-Modified: Tue, 21 Oct 2014 19:50:16 GMT
ETag: "8a7-505f423e62e00-gzip"
Accept-Ranges: bytes
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 1102
Cneonction: close
Content-Type: text/html

Need to find out who hosts Free SEO Report

Page Title of


Meta Description of

Meta Tags of

No tags found

Website Inpage Analysis for

H1 Headings:1
H2 Headings:0
H3 Headings:4
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:11
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

elseuex functiondrivefalsewindownavmettmpnew datewb 1datebeginwindownavmettmp windownavmettmpnewfontfamily arialsansserif2pxuexlduexwindownavmettmpnewifwindowgwi windowgwibillboardwidgetuex function uexlddategatewaynavsitewidemsgdesktop2windownavbardeclareonloaddatebeginwindownavmettmp windownavmettmpnew datewb14px1callbackfunction uexldwindowgwibillboardwidgetitemstextamazonnavbarnavprimedayarialsansseriflineheightifwindowgwiifdauexldnewnbsp nbspfontfamilywrapperselectorifwindowgwi windowgwibillboardwidget newtypeofdatebeginwindownavmettmpvarelse ifwindownav0pxnbsp nbsp nbspdelimiternbsp0nowreturnlineheight 14pxwindowgwibillboardwidget newamazonfunction

Longtail Keyword Density for

datebeginwindownavmettmp windownavmettmpnew date6
ifwindowgwi windowgwibillboardwidget new3
nbsp nbsp nbsp3
uex function uexld3
windownavmettmpnew date9
datebeginwindownavmettmp windownavmettmpnew8
nbsp nbsp4
ifwindowgwi windowgwibillboardwidget3
windowgwibillboardwidget new3
font-family arialsans-serif3
line-height 14px3
function uexld3
wb 13
else if3
uex function3

Alexa Traffic Rank for

Alexa Search Engine Traffic for

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States States United States States United States DNS Record Analysis DNS Lookup

Serial: 2010111125
Refresh: 600
Retry: 300
Expire: 3024000 10
Target: 10
Target: 10
Target: 10
Target: 10
Target: spf2.0/pra -all v=spf1 -all
