Website Analysis Summary  |  Low prices on digital cameras, MP3, sports equipment, books, music, DVDs, video games, home & garden and much more. Free UK delivery on millions of eligible products.
High trust score  | Low Prices in Electronics, Books, Sports Equipment & more

Trust Score
High trust score
Estimated worth
Estimated daily income
Estimated monthly income
0 has a High trust score, and a Statvoo Rank of A. is hosted by, Inc. in Dublin City, Dublin, Ireland, D8. has an IP Address of and a hostname of and runs Server web server.

The domain was registered 2 decades 3 years 6 months ago by , it was last modified 6 years 4 months 3 days ago and currently is set to expire 201 decades 9 years 4 months ago.

It is the world's 92 most popular site among over 300 million websites. has a total of 0 backlinks. gets approximately 20,326,087 unique visitors a day and 162,608,696 pageviews per day. has an estimated worth of $175,617,720.
An average daily income of approximately $162,609, which is wroughly $4,946,024 per month.

Whois information for

Full Whois Lookup for Whois Lookup

Domain name:

Amazon Europe Holding Technologies SCS

Registrant type:

Registrant's address:
65 boulevard G-D. Charlotte
Luxembourg City

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 10-Dec-2012

Registrar:, Inc. t/a, Inc. [Tag = AMAZON-COM]

Relevant dates:
Registered on: before Aug-1996
Expiry date: 05-Dec-2020
Last updated: 23-Oct-2013

Registration status:
Registered until expiry date.

Name servers: 2610:00a1:1017:0000:0000:0000:0000:0001

WHOIS lookup made at 22:36:26 17-Aug-2017

This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts Web Server Information

Hosted IP Address:
Hosted Hostname:
Service, Inc.
Hosted Country:IrelandIE
Location Latitude:53.344
Location Longitude:-6.26719
Webserver Software:Server

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 22 May 2015 14:54:07 GMT
Server: Server
pragma: no-cache
x-amz-id-1: 03345YDTCNXAWR1SF47P
cache-control: no-cache
x-frame-options: SAMEORIGIN
expires: -1
x-amz-id-2: zSot z0HBMu8AV9OFfLKIZE0ZJsfLioJYeIQqz3vfrOWwqLEkQm2B51UiskM3LyE
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Type: text/html; charset=ISO-8859-1
Transfer-Encoding: chunked

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:23
Amazon Devices
New Year New You
Deal of the Day
Sign in for your best experience
The Drop: fashion has a new lineup
Low-cost home d├ęcor
Headphones and Earphones Product Finder
Find your ideal TV
Bargain Finds
Memory and Storage Product Finder
Best Sellers in Fashion
Best Sellers in Sports & Outdoors
Phones & Accessories
Coffee Machine Product Finder
Great prices on Renewed products
Vacuum cleaner product finder
Best Sellers in Computers & Accessories
Best Sellers in Beauty
Speakers Product Finder
Monitor Product Finder
DIY & Tradesmen Store
Great prices on like-new smartphones
Women's most-loved watches
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:82
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

startsignuex functiongamesdatebeginwindownavmettmp windownavmettmpnew dateindustrymusicdeliveryuexlddauexldelsefunction uexlddatebeginwindownavmettmpkidsnewchildrendatemovies and tvwindowgwibillboardwidget newsongswindowgwibillboardwidgetdatebeginwindownavmettmp windownavmettmpnewittextamazon dashwishbookskindletryuex function uexldwindownavmettmpnewifcallbackshopping0moviesreadingnbspstreaminglovefilmfoodinnew customerwindownavbardeclareonloadvarneed when yougardenuexalexawindownavmettmpnew dateelse iffastnowifwindowgwimorefunctionprimereturndealsneedyou needwbhdfalseyoucustomeramazonshoesfree0pxhomeanyittextamazonwindownavnbsp nbsp nbspmoretextamazonneed ittextamazonarialsansserifneed ittextamazon dashdashtvdisplayallwb 1fontfamilyifwindowgwi windowgwibillboardwidget newtypeofpersonalifwindowgwi windowgwibillboardwidgetappstv musicbusinessinnewoffyou need ittextamazonmillioninnew customer startaccessoriesyour contentfontfamily arialsansserifyoursoftwarecarpantrymillion songsnbsp nbspfireshopcustomer startcontentvideodelimiter

Longtail Keyword Density for

datebeginwindownavmettmp windownavmettmpnew date5
movies and tv5
ifwindowgwi windowgwibillboardwidget new4
you need ittextamazon3
need ittextamazon dash3
need when you3
innew customer start3
nbsp nbsp nbsp3
uex function uexld3
windownavmettmpnew date9
datebeginwindownavmettmp windownavmettmpnew7
you need6
million songs4
your content4
windowgwibillboardwidget new4
nbsp nbsp4
ifwindowgwi windowgwibillboardwidget4
customer start3
function uexld3
need ittextamazon3
ittextamazon dash3
innew customer3
wb 13
uex function3
font-family arialsans-serif3
else if3
tv music3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry