Review - Online Shopping for Electronics, Apparel, Computers, Books, DVDs & more554
5 out of 5 based on 4 user ratings.  | Online Shopping for Electronics, Apparel, Computers, Books, DVDs & more
High trust score  | 
Online shopping from the earth's biggest selection of books, magazines, music, DVDs, videos, electronics, computers, software, apparel & accessories, shoes, jewelry, tools & hardware, housewares, furniture, sporting goods, beauty & personal care, broadband & dsl, gourmet food & just about anything else. Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:A+
Alexa Rank Alexa Rank:8
Majestic Rank Majestic Rank:24
Domain Authority Domain Authority:0%
DMOZ DMOZ Listing:No

Domain Information for

Domain Registrar: MARKMONITOR INC.
Registration Date:1994-11-01  2 decades 4 years 5 months ago
Last Modified:2014-04-30  4 years 11 months 2 weeks ago
Expiration Date:2022-10-31  3 years 6 months 1 week from now

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: AMAZON.COM
Registry Domain ID: 281209_DOMAIN_COM-VRSN
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2014-04-30T19:24:35Z
Creation Date: 1994-11-01T05:00:00Z
Registry Expiry Date: 2022-10-31T04:00:00Z
Registrar: MarkMonitor Inc.
Registrar IANA ID: 292
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.2083895740
Domain Status: clientDeleteProhibited
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
Domain Status: serverDeleteProhibited
Domain Status: serverTransferProhibited
Domain Status: serverUpdateProhibited
Name Server: NS1.P31.DYNECT.NET
Name Server: NS2.P31.DYNECT.NET
Name Server: NS3.P31.DYNECT.NET
Name Server: NS4.P31.DYNECT.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of whois database: 2017-08-15T10:57:07Z

Who hosts is hosted by, Inc. in Virginia, Ashburn, United States, 20149. has an IP Address of and a hostname of and runs Server web server. Web Server Information

Hosted IP Address:
Hosted Hostname:
Service, Inc.
Hosted Country:United StatesUS
Location Latitude:39.0481
Location Longitude:-77.4729
Webserver Software:Server

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Server
Date: Thu, 23 Feb 2017 00:22:53 GMT
Content-Type: text/html;charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Strict-Transport-Security: max-age=47474747; includeSubDomains; preload
Pragma: no-cache
Cache-Control: no-cache
Expires: -1
Vary: Accept-Encoding,User-Agent
Content-Language: en-US
X-Frame-Options: SAMEORIGIN
X-UA-Compatible: IE=edge
Content-Encoding: gzip

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

wbstorennnnn nnnnnoutcustomercfexecutefunctionaif1baby3more pwhencomponentfeedcarouselexecutefunctioncomponentfeedcarouselifwindowgwi windowgwibillboardwidgetfeedcarousel10 0 pwhenagamesdeals and moretextseeamazongetskinfeedcarousel 10 0contentmoviesshippingstartcustomer startcoconutwindowgwibillboardwidget newfalse datamoretextseepartsozmixmoretextamazonelectronicsnnnnn nnnnn nnnnvarmoreuex function uexlduexdatebeginwindownavmettmppwhenawindownavmettmpnew7itemsorganicalexasongs10 0computerscansee more pwhencomponentfeedcarouselexecutefunctioncomponentfeedcarouselsigninredirectpwhena cfexecutefunctionavariety packhomesnackaccountyourdata ntrymembersnnnnnappsfree shippingkidswindownavmettmpnew datefalsereadingessentialsfunctioninnew customerwindownavmoretextsee allgardennbspvideogofalse data ntypeoforiginalinnewdatebeginwindownavmettmp windownavmettmpnewshoesexclusiveif typeofbarspwhencomponentfeedcarouselexecutefunctioncomponentfeedcarousel0 pwhenaamazon primehduex functionn nnnnn nnnnncoconut oil0 pwhena cfexecutefunctionaandroidwindowgwibillboardwidgetproductsfontfamily arialsansserifhealthtvwholeout of 5youshoppingdevicessave5nbsp nbspnwindowgwdata windowgwdatamore pwhencomponentfeedcarouselexecutefunctioncomponentfeedcarousel componentfeedcarouselcreatecarouselrightpaymentcartw2departmentssmartloadedcardstruefirecss6loaded falsedatavarietyarialsansserifpackidelsewb 1lightifwindowgwiloaded false datafind dealsbooksdateseecrackersfontfamilywindowgwdatamdauexldinnew customer startnnnnn nnnnwindownavbardeclareonloadw1data n nnnnnnnnnfind84else iffeedcarousel 10function uexldreturnprimemusicselectpwhencomponentfeedcarouselexecutefunctioncomponentfeedcarousel componentfeedcarouselcreatecarouselmillionssee morecreditnewallcallbackuexldfire tvereadersnbsp nbsp nbspcomponentfeedcarouselcreatecarousel0delimiterconfignowsportsn nnnnnounceoilfree2businessyourdealsgourmetdatebeginwindownavmettmp windownavmettmpnew datennnnn nnnnn nnnnnkindleifwindowgwi windowgwibillboardwidget newspice

Longtail Keyword Density for

nnnnn nnnnn nnnnn28
out of 514
datebeginwindownavmettmp windownavmettmpnew date5
ifwindowgwi windowgwibillboardwidget new5
loaded false data5
data n nnnnn4
n nnnnn nnnnn4
nnnnn nnnnn nnnn4
false data n4
feed-carousel 10 04
10 0 pwhena4
0 pwhena cfexecutefunctiona4
deals and moretextsee3
innew customer start3
more pwhencomponent-feed-carouselexecutefunctioncomponentfeedcarousel componentfeedcarouselcreatecarousel3
nbsp nbsp nbsp3
uex function uexld3
see more pwhencomponent-feed-carouselexecutefunctioncomponentfeedcarousel3
nnnnn nnnnn32
variety pack10
windownavmettmpnew date9
datebeginwindownavmettmp windownavmettmpnew7
pwhena cfexecutefunctiona5
windowgwdata windowgwdata5
false data5
feed-carousel 105
loaded false5
pwhencomponent-feed-carouselexecutefunctioncomponentfeedcarousel componentfeedcarouselcreatecarousel5
windowgwibillboardwidget new5
ifwindowgwi windowgwibillboardwidget5
data n4
amazon prime4
n nnnnn4
nnnnn nnnn4
fire tv4
coconut oil4
0 pwhena4
10 04
nbsp nbsp4
moretextsee all3
find deals3
innew customer3
customer start3
free shipping3
function uexld3
wb 13
else if3
uex function3
see more3
more pwhencomponent-feed-carouselexecutefunctioncomponentfeedcarousel3
if typeof3
font-family arialsans-serif3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States States United States States United States States United States States United States Reviews

We have 4 review(s) for

Add your review

"overall genuine "

United States
apollonio1971725  (2 years ago)

found Amazon in a state of grace and feel that it has a lot to offer people and has been bringing smiles to many therefor its a good review


"Prime works well"

United States
ldmanachetti  (2 years ago)

When I need parts for my welding job, I can usually get them same day from amazon prime (if not, it's next day). In the past, I have also had to return some of my items. They usually take them without a hassle.



cjlegacion24  (2 years ago)



"Best online shopping site"

andrew  (2 years ago)

Best online shopping site

Need to find out if is a scam?