| Günstige Preise für Elektronik & Foto, Filme, Musik, Bücher, Games, Spielzeug & mehr
High trust score  | 
Entdecken, shoppen und einkaufen bei Günstige Preise für Elektronik & Foto, Filme, Musik, Bücher, Games, Spielzeug, Sportartikel, Drogerie & mehr bei Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:A
Alexa Rank Alexa Rank:88
Majestic Rank Majestic Rank:329
Domain Authority Domain Authority:94%
DMOZ DMOZ Listing:Yes

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
% Restricted rights.
% Terms and Conditions of Use
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:

Status: connect
Changed: 2016-07-18T17:06:08+02:00

Type: ROLE
Name: Amazon Europe Core S.a.r.l.
Organisation: Amazon Europe Core S.a.r.l.
Address: 5 rue Plaetis
PostalCode: L-2338
City: Luxembourg
CountryCode: LU
Phone: +352.26733300
Email: Login to show email

Type: ROLE
Name: Amazon Europe Core S.a.r.l.
Organisation: Amazon Europe Core S.a.r.l.
Address: 5 rue Plaetis
PostalCode: L-2338
City: Luxembourg
CountryCode: LU
Phone: +352.26733300
Email: Login to show email

Who hosts is hosted by, Inc. in Dublin City, Dublin, Ireland, D8. has an IP Address of and a hostname of and runs Server web server. Web Server Information

Hosted IP Address:
Hosted Hostname:
Service, Inc.
Hosted Country:IrelandIE
Location Latitude:53.344
Location Longitude:-6.26719
Webserver Software:Server

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 22 May 2015 14:49:38 GMT
Server: Server
pragma: no-cache
x-amz-id-1: 072JSGD47CJVZPK9NAWS
cache-control: no-cache
x-frame-options: SAMEORIGIN
expires: -1
x-amz-id-2: yhj8a6 q8j3wgIAG5ZG0tnFx89UCr4W0yods83xOvGoSlVJfW9F/d4HIovekz/nS
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Type: text/html; charset=ISO-8859-15
Transfer-Encoding: chunked

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

backgroundmarginvideolinkcallbacksindbeidatevideoplayingstateplayergetoffsetsviewportoffsetprimegartennone heightif typeofwindownavmettmpnewsieifarialsansserifairyready functionplayermaxwidthvideoplayingstateplayer ratioanchoroffsetairyvideo playeruncommencedupdateclosebuttondimensionsviewportheightstartenplayeruncommenced airyplaytogglehintairyplayhintamazonprime videozindexsie dieplayeruncommenced airysvgtop0scrolltopwindownav0pxnorepeatnbsp nbspairyvideocontainerdisplay none heightviewportoffsetnonedrogerieaspectratiowindowbei amazonprepareviewportneuenewesfunctioneventobjectimportant airyvideopositiontop 50marginselseimportantleftuexstateplayratio returnairyplaytogglehintairyplayhintpositionabsolute top0functioneventobject eventcontextdimensions getdimensionsratiofunction uexldreturn basestate playmillionen7heighttypeofuexldopacity 0functionplayer ratioleft 50position relativeplayeruncommencedreturn basestateimportant widthtrue2uex function uexlddisplay noneairypngvisiblebasestate airyreadyfrderpageairyready functionplayer ratiozunichtairyvideonspcs0wq88j9k0bpkssahq2619videoheighteventcontext1wb 1playerpausemehrfalseopacityheight dimensionsviewportheightstarten sieairyvideo playeruncommenced airysvgvideoreadystateplayer ratio3autotesten4fontsizeairyreadydieratio return basestatefilmentopneue firewidthvideowidthcenterwindowgwibillboardwidgetphotosappsdatebeginwindownavmettmp windownavmettmpnew datedvddatebeginwindownavmettmp windownavmettmpnewwindowheightwindownavbardeclareonloadairyvideoeinberallnbsp nbsp nbspzumanimateviewportindatebeginwindownavmettmptypeof uexplayerreadystateplayerviewportheightkindleinhaltebasestate airyready functionplayertypeof uex functioneinfachgetoffsetsviewportoffset anchoroffsetnbspdelimiterposition absoluteratiowb5300 function1500pxgetscrolloffsetsresizenowmusichaushaltwindowgwibillboardwidget newstopherotatorprimevorteilebottomreturnposition absolute topnoopalleabsolutebasestateheight 300pxistloadingscopeplayerreadystateplayer ratiovaroffsetsserien musikfontfamily arialsansserifimportant airyvideo playeruncommencedkidsfunctionplayerliveplayeruncommenced airypngcssvideoreadystateplayerlive bei0 0noop functionfallbacksongsplay function stateopacity 16jetztuex functioneinkaufswagendisplayifwindowgwi windowgwibillboardwidgetplay functionafterviewportresizednochstate100pxifwindowgwirelativeifwindowgwi windowgwibillboardwidget newmitinitialfontfamilybackgroundpositionairyvideocontainerinplaybackscopemusikscopegwdesktopherotatorbottom0if typeof uexherotatorreadyviewportloadedabsolute topairyvideotextlink0schuhelineheightviewportoffset viewportoffsetairyvideo airyvideotextlinkfirestopfunctionpositionabsolutehd300pxdimensionsihrbackgroundsizebasestate playplay50pxplayerfunction stateairyvideo playeruncommenced airyplaytogglehintairyplayhintairyvideo playeruncommenced airypngwindownavmettmpnew datevideodimensionsheightelse ifaufdiesesserienmillionen songslive bei amazonbermotorraddauexldgetdimensionsratioairyconfigvoncroppedimagemapsizecolorairysvg

Longtail Keyword Density for

ratio return basestate5
datebeginwindownavmettmp windownavmettmpnew date5
important airy-video player-uncommenced4
nbsp nbsp nbsp4
airyready functionplayer ratio3
basestate airyready functionplayer3
live bei amazon3
play function state3
return basestate play3
ifwindowgwi windowgwibillboardwidget new3
if typeof uex3
position absolute top3
display none height3
airy-video player-uncommenced airy-play-toggle-hintairy-play-hint3
airy-video player-uncommenced airy-png3
uex function uexld3
airy-video player-uncommenced airy-svg3
typeof uex function3
airy-video player-uncommenced12
windownavmettmpnew date9
important airy-video8
return basestate7
datebeginwindownavmettmp windownavmettmpnew7
display none7
function state6
if typeof6
ratio return5
airy-video airy-video-text-link5
nbsp nbsp5
bei amazon5
wb 15
0 04
functioneventobject eventcontext4
opacity 04
play function4
millionen songs4
else if4
neue fire4
uex function4
height dimensionsviewportheight4
position absolute4
noop function4
videoplayingstateplayer ratio3
dimensions getdimensionsratio3
basestate play3
ifwindowgwi windowgwibillboardwidget3
serien musik3
live bei3
sie die3
font-family arialsans-serif3
prime video3
playerreadystateplayer ratio3
starten sie3
windowgwibillboardwidget new3
300 function3
viewportoffset viewportoffset3
absolute top3
important width3
player-uncommenced airy-play-toggle-hintairy-play-hint3
none height3
position relative3
function uexld3
height 300px3
positionabsolute top03
left 503
top 503
basestate airyready3
airyready functionplayer3
functionplayer ratio3
getoffsetsviewportoffset anchoroffset3
typeof uex3
opacity 13
player-uncommenced airy-png3
player-uncommenced airy-svg3
videoreadystateplayer ratio3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States States United States States United States States United States States United States Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?