Online Shopping site in India: Shop Online for Mobiles, Books, Watches, Shoes and More - Amazon.in

Safety: High trust score
Year Founded: 2005
Global Traffic Rank: 112
Estimated Worth: $146,880,000

Amazon.in: Online Shopping India - Buy mobiles, laptops, cameras, books, watches, apparel, shoes and e-Gift Cards. Free Shipping & Cash on Delivery Available.



Domain summary

Last updated
2021-05-28
Domain label
amazon
Domain extension
in
Domain registered:
2005-11-02
Domain updated:
2021-05-28
Global Traffic Rank
112
Statvoo Rating
A
Trust Score
High trust score
Estimated worth
$146,880,000
Estimated daily income
$136,000
Estimated monthly income
$4,136,667

Frequently Asked Questions (FAQ)

Q: When was Amazon.in registered?
A: Amazon.in was registered 15 years, 7 months, 3 weeks, 1 day, 9 hours, 37 minutes, 46 seconds ago on Wednesday, November 2, 2005.
Q: When was the WHOIS for Amazon.in last updated?
A: The WHOIS entry was last updated 3 weeks, 6 days, 9 hours, 37 minutes, 46 seconds ago on Friday, May 28, 2021.
Q: What are Amazon.in's nameservers?
A: DNS for Amazon.in is provided by the following nameservers:
  • pdns1.ultradns.net
  • pdns2.ultradns.net
  • pdns3.ultradns.org
  • pdns4.ultradns.org
  • pdns5.ultradns.info
  • pdns6.ultradns.co.uk
  • ns1.p31.dynect.net
  • ns2.p31.dynect.net
Q: Who is the registrar for the Amazon.in domain?
A: The domain has been registered at INRegistry.
Q: What is the traffic rank for Amazon.in?
A: Amazon.in ranks 112 globally on Alexa. Amazon.in has a High trust score, and a Statvoo Rank of A.
Q: How many people visit Amazon.in each day?
A: Amazon.in receives approximately 17,000,000 visitors and 136,000,000 page impressions per day.
Q: What IP address does Amazon.in resolve to?
A: Amazon.in resolves to the IPv4 address 52.95.116.115.
Q: In what country are Amazon.in servers located in?
A: Amazon.in has servers located in the Ireland.
Q: What webserver software does Amazon.in use?
A: Amazon.in is powered by Server webserver.
Q: Who hosts Amazon.in?
A: Amazon.in is hosted by AMAZON-02 in Leinster, Dublin, Ireland, D02.
Q: How much is Amazon.in worth?
A: Amazon.in has an estimated worth of $146,880,000. An average daily income of approximately $136,000, which is roughly $4,136,667 per month.

Amazon.in Reviews

We have 2 review(s) for Amazon.in

Add your review
Verified

 (1 month ago)
 

"Awesome service"


Great service
Verified India

 (2 months ago)
 

"great website"


one of the best place to buy from

Amazon.in Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Amazon.in

H1 Headings

0 :

H2 Headings

27 :
  1. Electronics days | Deals starting ₹199
  2. Food & beverages
  3. Styles for Women | Up to 70% off
  4. Sign in for your best experience
  5. Styles for Men | Up to 70% off
  6. Everyday essentials
  7. Pay your credit card bills on Amazon
  8. Amazon Pay | Buy Google Play recharge code now
  9. Book tickets for essential travel
  10. Amazon's response to COVID-19
  11. Curated protective supply products | Amazon Launchpad
  12. Digital thermometers | Starting ₹299
  13. Pick from these types of masks
  14. Great quality & prices | Fruits & vegetables | Amazon fresh
  15. Masks Combo | Below ₹299
  16. For the well-being of your loved ones
  17. Essentials for your safety
  18. Masks and faceshields
  19. Cookware & dining
  20. Get ready to beat the heat
  21. Beauty products
  22. Best Sellers in Computers & Accessories
  23. Best Sellers in Grocery & Gourmet Foods
  24. Launching Spring Summer'21
  25. Handpicked products for your baby
  26. For your pets
  27. Family essentials | Amazon Brands & more

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

111 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

211:

Links - Internal (nofollow)

0:

Links - Outbound

27:

Links - Outbound (nofollow)

0:

Keyword Cloud for Amazon.in

carewindownavbarnonefontfamily arial verdanaboxshadowverdanaelsedisplay inlineblockdatebeginwindownavmettmp windownavmettmpnew datehelvetica800 fontsizee7e9ece7eaf0 d9dce1margintop 3pxheightleftfontsize 12px verticalalignfloatrgba0nowf7f8fa e7e9ec backgroundborder 0rgba0 0e7eaf00 1px 0baby3px 3pxcallonvisiblemarginbottomhelvetica sansserifbackground12px verticalalign0 0float leftwindownavdateinsetdatebeginwindowuet0cursor800 fontsize 12pxfontfamilyfontfamily arialrgba255e7e9ec background255 255verdana helveticafontweight normalfontstyle1px 3px0inlineblock3px rgba0 0windownavbardeclareonloadaccountfontsizefontweightfontstyle normal12px0 02 insetnavf7f8fanowrappagenbsp nbsp51pxgamescolor 800 fontsizeverticalalign bottomtextdecoration none255 255 06255 06giftyoursolidarialsansserifwhitespacewindowuet0fontsize 13px12px verticalalign bottom1px 3px rgba255startdatebeginwindownavmettmp11px13pxwish listinset 0positionfunctionif windowuet0arial verdanaprimevartextdecoration40 0 023px rgba255fontsize 11px3px rgba0border19pxarialfontstyle normal fontweightoverflowwebkitboxshadownbsp nbsp nbspverticalalignwhitespace nowrap255 06 insetoverflow hiddenmozboxshadowpersonal carefilterpersonald9dce13pxarial verdana helvetica0 1px 3pxtruebeauty75pxwishnormal fontweightrgba255 255hiddeniflineheight 19px02 insetnewdatebeginwindownavmettmp windownavmettmpnewsansserifdatainlineaddtocarthandlerf7f8fa e7e9ec120px06display nonelistwindownavmettmpnewfalseamazondisplay0 1pxe7eaf0 d9dce1 backgroundrgba255 255 255inset 0 1px23px rgba255 255margin06 inset1px 3px rgba00 0 ffftopmetriccolor 800verdana helvetica sansserifvideocolor1px 0bordercolorbiaitem310pxe47911paddingwindownavmettmpnew date02ffffontsize 12pxnormalhome0 02fontfamily arialsansserif1px 0 0bottomd9dce1 backgroundlineheightall0 fffreturnwidthbiahcbwidgetmargintop0px3px 3px 3pxnbsprgba0 0 0customertypeofoutdoors

Longtail Keyword Density for Amazon.in

KeywordsOccurences
0 1px 3px6
3px 3px 3px6
verdana helvetica sans-serif5
arial verdana helvetica5
font-family arial verdana5
datebeginwindownavmettmp windownavmettmpnew date4
f7f8fa e7e9ec background4
color 800 font-size4
e7eaf0 d9dce1 background4
nbsp nbsp nbsp4
3px rgba0 03
font-size 12px vertical-align3
800 font-size 12px3
0 02 inset3
0 0 023
rgba0 0 03
255 255 063
1px 3px rgba03
255 06 inset3
rgba255 255 2553
3px rgba255 2553
1px 3px rgba2553
0 0 fff3
1px 0 03
0 1px 03
inset 0 1px3
font-style normal font-weight3
12px vertical-align bottom3
0 1px9
3px 3px9
line-height 19px8
overflow hidden7
windownavmettmpnew date7
0 06
1px 3px6
font-size 12px6
e7e9ec background5
f7f8fa e7e9ec5
e7eaf0 d9dce15
d9dce1 background5
font-family arial5
verdana helvetica5
helvetica sans-serif5
nbsp nbsp5
arial verdana5
float left4
color 8004
800 font-size4
wish list4
display none4
datebeginwindownavmettmp windownavmettmpnew4
display inline-block4
text-decoration none4
1px 03
border 03
vertical-align bottom3
12px vertical-align3
personal care3
font-size 13px3
margin-top 3px3
font-family arialsans-serif3
font-size 11px3
white-space nowrap3
02 inset3
inset 03
0 023
rgba0 03
3px rgba03
06 inset3
255 063
255 2553
rgba255 2553
3px rgba2553
font-style normal3
normal font-weight3
font-weight normal3
0 fff3
if windowuet03
032
var26
3px24
function20
if17
background16
color16
font-size14
none14
display12
1px12
windownav11
your11
date10
0px10
line-height9
inset9
left9
width9
font-family8
f7f8fa8
19px8
overflow8
hidden7
17
vertical-align7
datebeginwindownavmettmp7
windownavmettmpnew7
normal7
data7
26
bia-item6
height6
e7e9ec6
12px6
nbsp6
amazon6
e7eaf06
d9dce16
return6
account5
font-weight5
false5
wish5
top5
e479115
windowuet05
bottom5
datebeginwindowuet05
games5
sans-serif5
helvetica5
verdana5
arial5
margin-top5
box-shadow5
new5
white-space4
10px4
float4
34
13px4
75px4
44
typeof4
list4
border-color4
padding4
video4
windownavbardeclareonload4
else4
inline-block4
nav4
prime4
home4
text-decoration4
cursor4
border4
all3
margin-bottom3
baby3
beauty3
true3
start3
windownavbar3
metric3
gift3
margin3
now3
inlineaddtocarthandler3
callonvisible3
page3
outdoors3
53
nowrap3
customer3
font-style3
arialsans-serif3
filter3
-webkit-box-shadow3
fff3
-moz-box-shadow3
bia-hcb-widget3
rgba2553
personal3
063
rgba03
023
care3
solid3
20px3
position3
11px3

Who hosts Amazon.in?

Amazon.in Hosting Provider Information

Hosted IP Address:52.95.116.115
Hosted Hostname:52.95.116.115
Service Provider:AMAZON-02
Hosted Country:IrelandIE
Location Latitude:53.3382
Location Longitude:-6.2591
Webserver Software:Server

Is "AMAZON-02" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
AMAZON-02
0.4796%

HTTP Header Analysis for Amazon.in

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Server
Content-Type: text/html;charset=UTF-8
x-amz-rid: 0V6VEJ4S5BW15JG7BB9S
Accept-CH-Lifetime: 86400
X-Content-Type-Options: nosniff
Cache-Control: no-transform
X-UA-Compatible: IE=edge
Content-Language: en-IN
X-XSS-Protection: 1;
Content-Encoding: gzip
Pragma: no-cache
Expires: -1
Accept-CH: ect,rtt,downlink
Strict-Transport-Security: max-age=47474747; includeSubDomains; preload
X-Frame-Options: SAMEORIGIN
Permissions-Policy: interest-cohort=()
Date: Fri, 28 May 2021 12:05:12 GMT
Transfer-Encoding: chunked
Connection: Transfer-Encoding
Vary: Accept-Encoding

Amazon.in Domain Nameserver Information

HostIP AddressCountry
pdns1.ultradns.net 204.74.108.1
pdns2.ultradns.net 204.74.109.1
pdns3.ultradns.org 199.7.68.1
pdns4.ultradns.org 199.7.69.1
pdns5.ultradns.info 204.74.114.1
pdns6.ultradns.co.uk 204.74.115.1
ns1.p31.dynect.net 208.78.70.31
ns2.p31.dynect.net 204.13.250.31


Need to find out who hosts Amazon.in?


Domain Registration (WhoIs) information for Amazon.in

 Domain Name: amazon.in
Registry Domain ID: D15860-IN
Registrar WHOIS Server:
Registrar URL: http://www.markmonitor.com
Updated Date: 2019-05-12T18:45:37Z
Creation Date: 2005-02-11T11:14:14Z
Registry Expiry Date: 2024-02-11T11:14:14Z
Registrar: MarkMonitor Inc.
Registrar IANA ID: 292
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: Amazon Technologies, Inc.
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: NV
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: US
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please contact the Registrar listed above
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please contact the Registrar listed above
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please contact the Registrar listed above
Name Server: ns2.p31.dynect.net
Name Server: ns1.p31.dynect.net
Name Server: pdns1.ultradns.net
Name Server: pdns6.ultradns.co.uk
Name Server: pdns2.ultradns.net
Name Server: pdns4.ultradns.org
Name Server: pdns5.ultradns.info
Name Server: pdns3.ultradns.org
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-05-28T12:05:13Z

Websites with Similar Names

Amazo-check1.club
Bitly | Page Not Found | 404
Amazo-tech.com
Laptops-Tablets
Amazo.ai
Hello, world!
Amazo.co.uk
amazo.co.uk -&nbspBooks Resources and Information.
Amazo.info
Amazon.com
Amazo.life
抱歉,站点已暂停
Amazo.live
403 Forbidden

Recently Updated Websites

Ingierd.com (2 seconds ago.)Hhcourier.com (2 seconds ago.)Theaddictionadvocate.com (3 seconds ago.)Telimena.pl (3 seconds ago.)Ssmetalindustries.com (4 seconds ago.)Citytaxdenhaag.nl (5 seconds ago.)Campusnaranja.com (6 seconds ago.)Adelaidecarremovals.com (6 seconds ago.)Babavanilla.com (7 seconds ago.)Plakatkayu.com (7 seconds ago.)Islandsecurityservices.com (9 seconds ago.)Tutto-posto.net (10 seconds ago.)Candidcousins.com (10 seconds ago.)Lusoacademia.org (11 seconds ago.)Pelitoro.com (11 seconds ago.)Drunkendonutsnj.com (12 seconds ago.)Reddeministroscristianos.com (12 seconds ago.)Modernmindfulparents.com (12 seconds ago.)Yizhaike.com (12 seconds ago.)Yaqi1727.vip (13 seconds ago.)Apcopywriting.com (13 seconds ago.)Yyvip786.com (14 seconds ago.)Agenzia-lapineta.it (15 seconds ago.)Distinctlytrue.com (15 seconds ago.)Lovfoods.com (16 seconds ago.)Etfstockreport.net (16 seconds ago.)Legendary-force.com (17 seconds ago.)Tgmotorsports.net (17 seconds ago.)Differenceandfrequency.com (18 seconds ago.)A-great-dry-eye.zone (19 seconds ago.)

Recently Searched Keywords

elige tus estudios (4 seconds ago.)assistenza condizionatore lg (8 seconds ago.)ventilation batiment elevage 53 (10 seconds ago.)jual produk cni nutrimoist phytolite surabaya - sahabatcni.com (11 seconds ago.)dirltr 3rcy (13 seconds ago.)無料でネットショップを開く (15 seconds ago.)situs jual hp bm terpercaya (16 seconds ago.)arsnovanyc (17 seconds ago.)www320hk (19 seconds ago.)cámaras de seguridad (24 seconds ago.)mutfa balkan trkleri (25 seconds ago.)right no-repeat homenotetitletextour (26 seconds ago.)bug reports  (26 seconds ago.)companies house (26 seconds ago.)lampleader (27 seconds ago.)jul 4 the july 4th riot of 1800 (27 seconds ago.)lezama: garitano, pendiente de yeray (28 seconds ago.)2020-09-9 2020-09-9 2020-09-9 (38 seconds ago.)20px dirrtl (40 seconds ago.)0 1px 0px (41 seconds ago.)joey  (41 seconds ago.)5000 6000 (42 seconds ago.)living communities urbn (43 seconds ago.)cifrafinancial (49 seconds ago.)zum inhalt springen (50 seconds ago.)amp drunck (50 seconds ago.)slide function (51 seconds ago.)305 am 0310 (52 seconds ago.)title 1 funding (54 seconds ago.)essayratio100optiondissertationratio150optiondissertation abstractratio150optiondissertation (55 seconds ago.)