Amazon.jobs: Help us build Earth’s most customer-centric company.

Safety: High trust score
Year Founded: 2020
Global Traffic Rank: 2,157
Estimated Worth: $6,748,920

We're a company of pioneers. It's our job to make bold bets, and we get our energy from inventing on behalf of customers. Success is measured against the possible, not the probable. For today’s pioneers, that’s exactly why there’s no place on Earth they’d rather build than Amazon.



Domain summary

Last updated
2020-12-12
Domain label
amazon
Domain extension
jobs
Global Traffic Rank
2,157
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$6,748,920
Estimated daily income
$6,249
Estimated monthly income
$190,074

Frequently Asked Questions (FAQ)

Q: When was Amazon.jobs registered?
A: Amazon.jobs was registered 6 months, 1 week, 2 days, 10 hours, 48 minutes, 12 seconds ago on Saturday, December 12, 2020.
Q: When was the WHOIS for Amazon.jobs last updated?
A: The WHOIS entry was last updated 6 months, 1 week, 2 days, 10 hours, 48 minutes, 12 seconds ago on Saturday, December 12, 2020.
Q: What are Amazon.jobs's nameservers?
A: DNS for Amazon.jobs is provided by the following nameservers:
  • ns-569.awsdns-07.net
  • ns-1891.awsdns-44.co.uk
  • ns-1475.awsdns-56.org
  • ns-400.awsdns-50.com
Q: Who is the registrar for the Amazon.jobs domain?
A: The domain has been registered at .
Q: What is the traffic rank for Amazon.jobs?
A: Amazon.jobs ranks 2,157 globally on Alexa. Amazon.jobs has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Amazon.jobs each day?
A: Amazon.jobs receives approximately 781,119 visitors and 6,248,952 page impressions per day.
Q: What IP address does Amazon.jobs resolve to?
A: Amazon.jobs resolves to the IPv4 address 54.239.39.201.
Q: In what country are Amazon.jobs servers located in?
A: Amazon.jobs has servers located in the Ireland.
Q: What webserver software does Amazon.jobs use?
A: Amazon.jobs is powered by Server webserver.
Q: Who hosts Amazon.jobs?
A: Amazon.jobs is hosted by Amazon.com, Inc. in Leinster, Dublin, Ireland, D02.
Q: How much is Amazon.jobs worth?
A: Amazon.jobs has an estimated worth of $6,748,920. An average daily income of approximately $6,249, which is roughly $190,074 per month.

Amazon.jobs Reviews

We have 1 review(s) for Amazon.jobs

Add your review
Verified United Arab Emirates

 (6 days ago)
 

"GREAT WORK"


GREAT WORK

Amazon.jobs Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Amazon.jobs

H1 Headings

2 :
  1. Find jobs
  2. Come build the future with us

H2 Headings

2 :
  1. Explore opportunities
  2. Sabrina

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-46526105-2

Links - Internal (nofollow)

0:

Links - Outbound

6:

Links - Outbound (nofollow)

0:

Keyword Cloud for Amazon.jobs

di lavoromedia actioncxtanalyticscaptureeventcategory socialhercxtanalyticscaptureeventcategorysocialsharephonelabelfooter directcallidentifier socialshareeventdetails socialplatformsocial mediaopportunittodocustomer servicetierceservicesocial media actioncustomerseventdetailsmedia action clickleusedcustomerdiamazonsocialifpermilitaryclicklinkdirectcallidentifier socialsharelink on footerlavorofooter directcallidentifierpagesocialplatformmediafootersocialshare eventdetails socialplatformaction click labelhomejobmycxtanalyticscaptureeventcategory social mediashebecausenewhaveclick labeldirectcallidentifier socialshare eventdetailsaction clickdirectcallidentifiersocialshare eventdetailsaction

Longtail Keyword Density for Amazon.jobs

KeywordsOccurences
cxtanalyticscaptureeventcategory social media4
social media action4
media action click4
action click label4
link on footer4
footer directcallidentifier socialshare4
directcallidentifier socialshare eventdetails4
socialshare eventdetails socialplatform4
cxtanalyticscaptureeventcategory social4
social media4
media action4
action click4
click label4
footer directcallidentifier4
directcallidentifier socialshare4
socialshare eventdetails4
eventdetails socialplatform4
customer service3
di lavoro3
di12
amazon6
per6
her5
service5
eventdetails5
tierce5
home5
label4
click4
action4
media4
social4
cxtanalyticscaptureeventcategory4
directcallidentifier4
she4
socialshare4
job4
footer4
phone4
customers4
socialplatform4
military4
link4
lavoro3
todo3
page3
customer3
if3
because3
new3
my3
have3
le3
opportunit3
used3

Who hosts Amazon.jobs?

Amazon.jobs Hosting Provider Information

Hosted IP Address:54.239.39.201
Hosted Hostname:54.239.39.201
Service Provider:Amazon.com, Inc.
Hosted Country:IrelandIE
Location Latitude:53.3338
Location Longitude:-6.2488
Webserver Software:Server

Is "Amazon.com, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
Amazon.com, Inc.
0.8593%

HTTP Header Analysis for Amazon.jobs

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Server
Date: Sat, 12 Dec 2020 07:09:19 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 8065
Connection: keep-alive
x-amz-rid: DRJRD18N4RS076GX0A06
Cache-Control: max-age=0, private, must-revalidate
Referrer-Policy: strict-origin-when-cross-origin
X-Permitted-Cross-Domain-Policies: none
X-XSS-Protection: 1; mode=block
X-Request-Id: 87e5482d-c20a-41a5-b1e5-04a22e99989e
X-Download-Options: noopen
X-Frame-Options: SAMEORIGIN
X-Runtime: 0.069448
X-Content-Type-Options: nosniff
ETag: W/"4f1a3df9c6e50330166a68a730566e7f-gzip"
Content-Encoding: gzip
Vary: Accept-Encoding,User-Agent,Content-Type,Accept-Encoding,X-Amzn-CDN-Cache,X-Amzn-AX-Treatment,User-Agent

Amazon.jobs Domain Nameserver Information

HostIP AddressCountry
ns-569.awsdns-07.net 205.251.194.57
ns-1891.awsdns-44.co.uk 205.251.199.99
ns-1475.awsdns-56.org 205.251.197.195
ns-400.awsdns-50.com 205.251.193.144


Need to find out who hosts Amazon.jobs?


Domain Registration (WhoIs) information for Amazon.jobs

Websites with Similar Names

Amazo-check1.club
Bitly | Page Not Found | 404
Amazo-tech.com
Laptops-Tablets
Amazo.ai
Hello, world!
Amazo.co.uk
amazo.co.uk -&nbspBooks Resources and Information.
Amazo.info
Amazon.com
Amazo.life
抱歉,站点已暂停
Amazo.live
403 Forbidden

Recently Updated Websites

Cleargoldvape.com (4 seconds ago.)Pharmacentrale.ch (4 seconds ago.)Movedatahouse.com (5 seconds ago.)Solar-boaventura.com (6 seconds ago.)Cbd-royal.shop (7 seconds ago.)Mobileworknow.com (7 seconds ago.)Oettersdorf.de (8 seconds ago.)Redessocialesparaempresarios.com (9 seconds ago.)Freddyjaco.com (9 seconds ago.)Amcits.com (9 seconds ago.)Thelifesettlementfiduciary.net (11 seconds ago.)Koddledkitty.com (11 seconds ago.)Baobabsbcn.com (11 seconds ago.)Orangecountyresearchinstitute.com (13 seconds ago.)Kxcteam.com (13 seconds ago.)Smokeinpeacenation.org (15 seconds ago.)Sfhun.com.tw (15 seconds ago.)Yayuvip1438.vip (15 seconds ago.)Hustlersforhumanity.org (16 seconds ago.)Abrantesadvogados.com (18 seconds ago.)Qqelang.asia (19 seconds ago.)Glitch-oz.com (19 seconds ago.)Connectoff.store (19 seconds ago.)Extraslutty.com (19 seconds ago.)Jgcrimlaw.com (19 seconds ago.)Xpressdns-host.com (22 seconds ago.)Mfnav.com (22 seconds ago.)Ikonautomotive.com (23 seconds ago.)Pingcheing.com (23 seconds ago.)Vestidosdenoivacuritiba.com (24 seconds ago.)

Recently Searched Keywords

form-wrapper inputtypesubmithoversqs-slide-wrapperdata-slide-typelock-screen (1 second ago.)smart corner offers (2 seconds ago.)home audio (3 seconds ago.)cleaning handyman (5 seconds ago.)koullarn (6 seconds ago.)road theatres (6 seconds ago.)������������8��27��΢��ÿ��һ������ (7 seconds ago.)jogjacamp (8 seconds ago.)nerul escort (11 seconds ago.)सड़क के बिना लोगों का बुरा हाल बारिश के रुके हुए पानी से 809 days ago (11 seconds ago.)we’re hiring! (12 seconds ago.)amin-ebrahimi (13 seconds ago.)2018-09-12 (14 seconds ago.)10s linear (16 seconds ago.)hablen (16 seconds ago.)kurse (17 seconds ago.)https: content3.fwwgo.com alsscan.com 0800 orig_[01-99].jpg (18 seconds ago.)create a registry (19 seconds ago.)stratton (19 seconds ago.)洛丽塔 (20 seconds ago.)ybty324 (21 seconds ago.)movilidad para tecnicos de sat (21 seconds ago.)watch the trailer (22 seconds ago.)your transmissions (23 seconds ago.)christophe robin (23 seconds ago.)hadh season 2 promo (26 seconds ago.)ixxxi ringen (28 seconds ago.)aactive n margin-left (28 seconds ago.)tricked30.7k (28 seconds ago.)博天堂 (29 seconds ago.)