Amazonlumberyard.us

Website Thumbnail
Checking...
Fully Customizable Game Engine - Amazon Lumberyard -Amazon Web Services

Safety: Low trust score
Year Founded: 2000
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-29
Category: This site has not been categorized yet

Amazon Lumberyard is a game engine with no royalties or seat fees, frictionless integration with Twitch and AWS, plus much more on the horizon. Download the latest version for free.


Domain summary

Domain label
amazonlumberyard
Domain extension
us
Domain registered:
2000-02-09
Domain updated:
2020-10-29
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is amazonlumberyard.us ranked relative to other sites:

Percentage of visits to amazonlumberyard.us from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Amazonlumberyard.us registered?
A: Amazonlumberyard.us was registered 20 years, 9 months, 3 weeks, 23 hours, 34 minutes, 13 seconds ago on Wednesday, February 9, 2000.
Q: When was the WHOIS for Amazonlumberyard.us last updated?
A: The WHOIS entry was last updated 1 month, 3 days, 23 hours, 34 minutes, 13 seconds ago on Thursday, October 29, 2020.
Q: What are Amazonlumberyard.us's nameservers?
A: DNS for Amazonlumberyard.us is provided by the following nameservers:
  • nsgbr.comlaude.co.uk
  • nsusa.comlaude.net
  • nssui.comlaude.ch
Q: Who is the registrar for the Amazonlumberyard.us domain?
A: The domain has been registered at NEUSTAR INC..
Q: What is the traffic rank for Amazonlumberyard.us?
A: Amazonlumberyard.us has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Amazonlumberyard.us each day?
A: Amazonlumberyard.us receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Amazonlumberyard.us resolve to?
A: Amazonlumberyard.us resolves to the IPv4 address 94.199.146.85.
Q: In what country are Amazonlumberyard.us servers located in?
A: Amazonlumberyard.us has servers located in the United Kingdom.
Q: What webserver software does Amazonlumberyard.us use?
A: Amazonlumberyard.us is powered by CloudFront webserver.
Q: Who hosts Amazonlumberyard.us?
A: Amazonlumberyard.us is hosted by City LifeLine Limited in United Kingdom.
Q: How much is Amazonlumberyard.us worth?
A: Amazonlumberyard.us has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Amazonlumberyard.us Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Amazonlumberyard.us Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Amazonlumberyard.us

H1 Headings

9 :
  1. Amazon Lumberyard
  2. Free. Powerful. Fully Customizable.
  3. Amazon Lumberyard
  4. Ready to Get Started with Lumberyard?
  5. Getting Started with Lumberyard
  6. From the Blog 
  7. Around the Web
  8. Built with Lumberyard
  9. Built with Lumberyard

H2 Headings

7 :
  1. Announcing Amazon Lumberyard 1.26
  2. With an updated UI and Starter Game project, Lumberyard 1.25 is better than ever
  3. Chock full of improvements, Lumberyard Beta 1.24.0.0 now brings you updates to Script Canvas, PhysX, the core editor, and more!
  4. Carbonated Games teases mobile shooter on Amazon Lumberyard
  5. Denis Dyack is coming back from the dead with Deadhaus Sonata
  6. Carbonated Games teases mobile shooter on Amazon Lumberyard
  7. Denis Dyack is coming back from the dead with Deadhaus Sonata

H3 Headings

14 :
  1. Free. Powerful. Fully Customizable.
  2. Build Bigger.
  3. Build a Fanbase.
  4. Build Free.
  5. Quickly learn essential Lumberyard tools and workflows while building a game prototype in the Getting Started Guide video series.
  6. More Tutorials
  7. Community
  8. Documentation
  9. Download Samples
  10. Around the Web
  11. Learn About AWS
  12. Resources for AWS
  13. Developers on AWS
  14. Help

H4 Headings

7 :
  1. October 5, 2020
  2. July 17, 2020
  3. May 15, 2020
  4. March 9, 2019
  5. February 21, 2019
  6. March 9, 2019
  7. February 21, 2019

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

34 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

66:
  1. Amazonlumberyard Contact Sales
    http://amazonlumberyard.us/contact-us/?nc2=h_header
  2. Amazonlumberyard Products
    http://amazonlumberyard.us/products/?nc2=h_ql_prod
  3. Amazonlumberyard Solutions
    http://amazonlumberyard.us/solutions/?nc2=h_ql_sol
  4. Amazonlumberyard Pricing
    http://amazonlumberyard.us/pricing/?nc2=h_ql_pr
  5. Amazonlumberyard Learn
    http://amazonlumberyard.us/getting-started/?nc2=h_ql_le
  6. Amazonlumberyard Partner Network
    http://amazonlumberyard.us/partners/?nc2=h_ql_pn
  7. Amazonlumberyard Customer Enablement
    http://amazonlumberyard.us/customer-enablement/?nc2=h_ql_ce
  8. Amazonlumberyard Events
    http://amazonlumberyard.us/events/?nc2=h_ql_ev
  9. Amazonlumberyard Explore More
    http://amazonlumberyard.us/contact-us/?nc2=h_ql_exm
  10. Amazonlumberyard Knowledge Center
    http://amazonlumberyard.us/premiumsupport/knowledge-center/?nc2=h_m_ma
  11. Amazonlumberyard AWS Support Overview
    http://amazonlumberyard.us/premiumsupport/?nc2=h_m_bc
  12. Amazonlumberyard Pricing
    http://amazonlumberyard.us/{{pricingUrl}}
  13. Amazonlumberyard Documentation
    http://amazonlumberyard.us/{{docsUrl}}
  14. Amazonlumberyard Calculator
    http://amazonlumberyard.us/{{calculatorUrl}}
  15. Amazonlumberyard Products
    http://amazonlumberyard.us/products/?nc2=h_mo
  16. Amazonlumberyard Solutions
    http://amazonlumberyard.us/solutions/?nc2=h_mo
  17. Amazonlumberyard Pricing
    http://amazonlumberyard.us/pricing/?nc2=h_mo
  18. Amazonlumberyard Introduction to AWS
    http://amazonlumberyard.us/what-is-aws/?nc2=h_mo
  19. Amazonlumberyard Getting Started
    http://amazonlumberyard.us/getting-started/?nc2=h_mo
  20. Amazonlumberyard Documentation
    http://amazonlumberyard.us/documentation/?nc2=h_mo
  21. Amazonlumberyard Training and Certification
    http://amazonlumberyard.us/training/?nc2=h_mo
  22. Amazonlumberyard Developer Center
    http://amazonlumberyard.us/developer/?nc2=h_mo
  23. Amazonlumberyard Customer Success
    http://amazonlumberyard.us/solutions/case-studies/?nc2=h_mo
  24. Amazonlumberyard Partner Network
    http://amazonlumberyard.us/partners/?nc2=h_mo
  25. Amazonlumberyard Download the Mobile App
    http://amazonlumberyard.us/console/mobile/
  26. Amazonlumberyard Amazon Lumberyard
    http://amazonlumberyard.us/lumberyard/
  27. Amazonlumberyard Overview
    http://amazonlumberyard.us/lumberyard/
  28. Amazonlumberyard Features
    http://amazonlumberyard.us/lumberyard/details/
  29. Amazonlumberyard FAQs
    http://amazonlumberyard.us/lumberyard/faq/
  30. Amazonlumberyard Downloads
    http://amazonlumberyard.us/lumberyard/downloads/
  31. Amazonlumberyard Videos
    http://amazonlumberyard.us/lumberyard/videos/
  32. Amazonlumberyard Get Lumberyard
    http://amazonlumberyard.us/lumberyard/download-lumberyard/
  33. Amazonlumberyard Ready to Get Started with Lumberyard?
    http://amazonlumberyard.us/lumberyard/gettingstarted/
  34. Amazonlumberyard Quickly learn essential Lumberyard tools and workflows while building a game prototype in the Getting Started Guide video series.
    http://amazonlumberyard.us/lumberyard/gettingstarted/
  35. Amazonlumberyard Getting Started with Lumberyard
    http://amazonlumberyard.us/lumberyard/gettingstarted/
  36. Amazonlumberyard Quickly learn essential Lumberyard tools and workflows while building a game prototype in the Getting Started Guide video series. 
    http://amazonlumberyard.us/lumberyard/gettingstarted/
  37. Amazonlumberyard Watch Now
    http://amazonlumberyard.us/lumberyard/gettingstarted/
  38. Amazonlumberyard Visit the features page
    http://amazonlumberyard.us/lumberyard/details/
  39. Amazonlumberyard Download Now
    http://amazonlumberyard.us/lumberyard/download-lumberyard/
  40. Amazonlumberyard Contact us
    http://amazonlumberyard.us/contact-us/
  41. Amazonlumberyard What Is AWS?
    http://amazonlumberyard.us/what-is-aws/?nc1=f_cc
  42. Amazonlumberyard What Is Cloud Computing?
    http://amazonlumberyard.us/what-is-cloud-computing/?nc1=f_cc
  43. Amazonlumberyard What Is DevOps?
    http://amazonlumberyard.us/devops/what-is-devops/?nc1=f_cc
  44. Amazonlumberyard What Is a Container?
    http://amazonlumberyard.us/containers/?nc1=f_cc
  45. Amazonlumberyard What Is a Data Lake?
    http://amazonlumberyard.us/big-data/datalakes-and-analytics/what-is-a-data-lake/?nc1=f_cc
  46. Amazonlumberyard AWS Cloud Security
    http://amazonlumberyard.us/security/?nc1=f_cc
  47. Amazonlumberyard What's New
    http://amazonlumberyard.us/new/?nc1=f_cc
  48. Amazonlumberyard Blogs
    http://amazonlumberyard.us/blogs/?nc1=f_cc
  49. Amazonlumberyard Getting Started
    http://amazonlumberyard.us/getting-started/?nc1=f_cc
  50. Amazonlumberyard Training and Certification
    http://amazonlumberyard.us/training/?nc1=f_cc
  51. Amazonlumberyard AWS Solutions Portfolio
    http://amazonlumberyard.us/solutions/?nc1=f_cc
  52. Amazonlumberyard Architecture Center
    http://amazonlumberyard.us/architecture/?nc1=f_cc
  53. Amazonlumberyard Product and Technical FAQs
    http://amazonlumberyard.us/faqs/?nc1=f_dr
  54. Amazonlumberyard Analyst Reports
    http://amazonlumberyard.us/resources/analyst-reports/?nc1=f_cc
  55. Amazonlumberyard AWS Partner Network
    http://amazonlumberyard.us/partners/?nc1=f_dr
  56. Amazonlumberyard Developer Center
    http://amazonlumberyard.us/developer/?nc1=f_dr
  57. Amazonlumberyard SDKs & Tools
    http://amazonlumberyard.us/developer/tools/?nc1=f_dr
  58. Amazonlumberyard .NET on AWS
    http://amazonlumberyard.us/developer/language/net/?nc1=f_dr
  59. Amazonlumberyard Python on AWS
    http://amazonlumberyard.us/developer/language/python/?nc1=f_dr
  60. Amazonlumberyard Java on AWS
    http://amazonlumberyard.us/developer/language/java/?nc1=f_dr
  61. Amazonlumberyard PHP on AWS
    http://amazonlumberyard.us/developer/language/php/?nc1=f_cc
  62. Amazonlumberyard Javascript on AWS
    http://amazonlumberyard.us/developer/language/javascript/?nc1=f_dr
  63. Amazonlumberyard Contact Us
    http://amazonlumberyard.us/contact-us/?nc1=f_m
  64. Amazonlumberyard Knowledge Center
    http://amazonlumberyard.us/premiumsupport/knowledge-center/?nc1=f_dr
  65. Amazonlumberyard AWS Support Overview
    http://amazonlumberyard.us/premiumsupport/?nc1=f_dr
  66. Amazonlumberyard Legal
    http://amazonlumberyard.us/legal/?nc1=f_cc

Links - Internal (nofollow)

0:

Links - Outbound

68:
  1. Amazonlumberyard Click here to return to Amazon Web Services homepage
    https://aws.amazon.com/?nc2=h_lg
  2. Amazonlumberyard Create an AWS Account
    https://portal.aws.amazon.com/gp/aws/developer/registration/index.html?nc2=h_ct&src=default
  3. Amazonlumberyard Documentation
    https://docs.aws.amazon.com/index.html?nc2=h_ql_doc
  4. Amazonlumberyard AWS Marketplace
    https://aws.amazon.com/marketplace/?nc2=h_ql_mp
  5. Amazonlumberyard عربي
    https://aws.amazon.com/ar/?nc1=h_ls
  6. Amazonlumberyard Bahasa Indonesia
    https://aws.amazon.com/id/?nc1=h_ls
  7. Amazonlumberyard Deutsch
    https://aws.amazon.com/de/?nc1=h_ls
  8. Amazonlumberyard English
    https://aws.amazon.com/?nc1=h_ls
  9. Amazonlumberyard Español
    https://aws.amazon.com/es/?nc1=h_ls
  10. Amazonlumberyard Français
    https://aws.amazon.com/fr/?nc1=h_ls
  11. Amazonlumberyard Italiano
    https://aws.amazon.com/it/?nc1=h_ls
  12. Amazonlumberyard Português
    https://aws.amazon.com/pt/?nc1=h_ls
  13. Amazonlumberyard Tiếng Việt
    https://aws.amazon.com/vi/?nc1=f_ls
  14. Amazonlumberyard Türkçe
    https://aws.amazon.com/tr/?nc1=h_ls
  15. Amazonlumberyard Ρусский
    https://aws.amazon.com/ru/?nc1=h_ls
  16. Amazonlumberyard ไทย
    https://aws.amazon.com/th/?nc1=f_ls
  17. Amazonlumberyard 日本語
    https://aws.amazon.com/jp/?nc1=h_ls
  18. Amazonlumberyard 한국어
    https://aws.amazon.com/ko/?nc1=h_ls
  19. Amazonlumberyard 中文 (简体)
    https://aws.amazon.com/cn/?nc1=h_ls
  20. Amazonlumberyard 中文 (繁體)
    https://aws.amazon.com/tw/?nc1=h_ls
  21. Amazonlumberyard AWS Management Console
    https://console.aws.amazon.com/?nc2=h_m_mc
  22. Amazonlumberyard Account Settings
    https://portal.aws.amazon.com/gp/aws/manageYourAccount?nc2=h_m_ma
  23. Amazonlumberyard Billing & Cost Management
    https://console.aws.amazon.com/billing/home?nc2=h_m_bc
  24. Amazonlumberyard Security Credentials
    https://console.aws.amazon.com/iam/home?nc2=h_m_sc#security_credential
  25. Amazonlumberyard AWS Personal Health Dashboard
    https://phd.aws.amazon.com/?nc2=h_m_sc
  26. Amazonlumberyard Support Center
    https://console.aws.amazon.com/support/home/?nc2=h_ql_cu
  27. Amazonlumberyard AWS Marketplace
    https://aws.amazon.com/marketplace/?nc2=h_mo
  28. Amazonlumberyard Support
    https://console.aws.amazon.com/support/home?nc2=h_ql_cu
  29. Amazonlumberyard Log into Console
    https://console.aws.amazon.com/console/home
  30. https://www.youtube.com/amazonlumberyardtutorials
    https://www.youtube.com/amazonlumberyardtutorials
  31. Amazonlumberyard Learn how to use the editor and more.
    https://www.youtube.com/amazonlumberyardtutorials
  32. https://gamedev.amazon.com/forums/index.html
    https://gamedev.amazon.com/forums/index.html
  33. Amazonlumberyard Talk with them on our forums.
    https://gamedev.amazon.com/forums/index.html
  34. https://aws.amazon.com/documentation/lumberyard/
    https://aws.amazon.com/documentation/lumberyard/
  35. Amazonlumberyard Learn more.
    https://aws.amazon.com/documentation/lumberyard/
  36. https://aws.amazon.com/lumberyard/downloads/
    https://aws.amazon.com/lumberyard/downloads/
  37. Amazonlumberyard See Available Samples.
    https://aws.amazon.com/lumberyard/downloads/
  38. Amazonlumberyard Introduction to Building Games on AWS using Amazon Lumberyard
    https://www.aws.training/Details/eLearning?id=42703
  39. Amazonlumberyard Start Free Training
    https://www.aws.training/Details/eLearning?id=42703
  40. Amazonlumberyard From the Blog 
    https://aws.amazon.com/blogs/gametech/
  41. Amazonlumberyard Announcing Amazon Lumberyard 1.26
    https://aws.amazon.com/blogs/gametech/announcing-amazon-lumberyard-release-1-26/
  42. Amazonlumberyard Let's usher in a new season of game development with the release of Amazon Lumberyard Beta 1.26! This release brings you improvements to Dynamic Terrain and Landscape Canvas, general availability of the PhysX Gem, updated Amazon GameLift support, usability improvements to the White Box Tool, and more.
    https://aws.amazon.com/blogs/gametech/announcing-amazon-lumberyard-release-1-26/
  43. Amazonlumberyard With an updated UI and Starter Game project, Lumberyard 1.25 is better than ever
    https://aws.amazon.com/blogs/gametech/1-25
  44. Amazonlumberyard Lumberyard 1.25 is available now, bringing you an updated UI, an updated Starter Game project to help you get set up with best practices, and the brand new White Box Tool. Check out some of our favorite updates.
    http://aws.amazon.com/blogs/gametech/1-25
  45. Amazonlumberyard Chock full of improvements, Lumberyard Beta 1.24.0.0 now brings you updates to Script Canvas, PhysX, the core editor, and more!
    https://aws.amazon.com/blogs/gametech/1-24
  46. Amazonlumberyard Spring has sprung, and it’s time for a fresh release of Amazon Lumberyard beta! We’re very pleased to bring you version 1.24.0.0, which contains many improvements to the Lumberyard engine and tools, particularly around quality of life with Script Canvas, the core editor, and asset bundling.
    https://aws.amazon.com/blogs/gametech/1-24/
  47. Amazonlumberyard Around the Web
    https://aws.amazon.com/blogs/gametech/
  48. Amazonlumberyard Carbonated Games teases mobile shooter on Amazon Lumberyard
    https://venturebeat.com/2019/03/09/carbonated-game-studio-teases-mobile-shooter-game-on-amazon-lumberyard/
  49. Amazonlumberyard In an interview with GamesBeat, Boatman said that the El Segundo, California-based company has gone big with Amazon, using its game tools such as GameLift and Amazon Web Services.
    https://venturebeat.com/2019/03/09/carbonated-game-studio-teases-mobile-shooter-game-on-amazon-lumberyard/
  50. Amazonlumberyard Denis Dyack is coming back from the dead with Deadhaus Sonata
    https://venturebeat.com/2019/02/21/denis-dyack-is-coming-back-from-the-dead-with-deadhaus-sonata/
  51. Amazonlumberyard I’m coming back from the dead. We’re using Amazon Lumberyard, and the way we’re using it speaks to a new type of gaming mentality for a new marketplace, which is yielding itself every day.
    https://venturebeat.com/2019/02/21/denis-dyack-is-coming-back-from-the-dead-with-deadhaus-sonata/
  52. Amazonlumberyard March 9, 2019
    http://www.tomshardware.com/news/amazon-lumberyard-beta-1.12-updates,36136.html
  53. Amazonlumberyard In an interview with GamesBeat, Boatman said that the El Segundo, California-based company has gone big with Amazon, using its game tools such as Gamelift and Amazon Web Services.
    https://venturebeat.com/2019/03/09/carbonated-game-studio-teases-mobile-shooter-game-on-amazon-lumberyard/
  54. https://twitter.com/amznlumberyard?lang=en
    https://twitter.com/amznlumberyard?lang=en
  55. https://www.facebook.com/amazonlumberyard/
    https://www.facebook.com/amazonlumberyard/
  56. https://www.youtube.com/channel/UCQH55cT_em5E8XU2J8erMKA
    https://www.youtube.com/channel/UCQH55cT_em5E8XU2J8erMKA
  57. Amazonlumberyard Sign In to the Console
    https://console.aws.amazon.com/console/home?nc1=f_ct&src=footer-signin-mobile
  58. Amazonlumberyard Press Releases
    https://press.aboutamazon.com/press-releases/aws
  59. Amazonlumberyard AWS Careers
    https://www.amazon.jobs/aws
  60. Amazonlumberyard File a Support Ticket
    https://console.aws.amazon.com/support/home/?nc1=f_dr
  61. Amazonlumberyard Create an AWS Account
    https://portal.aws.amazon.com/gp/aws/developer/registration/index.html?nc1=f_ct&src=default
  62. https://twitter.com/awscloud
    https://twitter.com/awscloud
  63. https://www.facebook.com/amazonwebservices
    https://www.facebook.com/amazonwebservices
  64. https://www.twitch.tv/aws
    https://www.twitch.tv/aws
  65. https://aws.amazon.com/podcasts/aws-podcast/
    https://aws.amazon.com/podcasts/aws-podcast/
  66. https://pages.awscloud.com/communication-preferences?trk=homepage
    https://pages.awscloud.com/communication-preferences?trk=homepage
  67. Amazonlumberyard Privacy
    https://aws.amazon.com/privacy/?nc1=f_pr
  68. Amazonlumberyard Site Terms
    https://aws.amazon.com/terms/?nc1=f_pr

Links - Outbound (nofollow)

0:

Keyword Cloud for Amazonlumberyard.us

amazon lumberyardwepricingpartnerpartner networkusefreenointegrationherenowwereseat feesmorenbspdeadsupporteverythandownloadseatcommunity0buildhelpbuiltgetreleasemarketplacewhichif if1typefeesweb servicesawswebconsolecentergettingtrainingbetasolutionslumberyard betaimprovementscoming backamazonhavefutureeveroverviewusing amazon lumberyardamazon web servicescominggamesenginelearngetting startedwere usingnewhasususingourtoolsifcanvasgametutorialsdeveloperscloudmobilebestfeaturesbuildingeditorbacktwitchcontactbuilt with lumberyardusing amazonanotheryouramazon webavailableservicesproductsgameliftitsaccountnew typeyounetworkupdatedlumberyardarounddocumentationstarted

Longtail Keyword Density for Amazonlumberyard.us

KeywordsOccurences
amazon web services5
using amazon lumberyard3
built with lumberyard3
amazon lumberyard12
amazon web5
web services5
getting started5
coming back4
were using4
new type4
partner network3
if if3
seat fees3
using amazon3
lumberyard beta3
lumberyard36
aws27
amazon25
game14
more13
nbsp12
using11
learn10
new9
if9
were8
support8
you7
tools7
web7
games7
started6
free6
center6
services6
us6
building5
getting5
get5
build5
partner5
has5
community4
type4
future4
solutions4
now4
have4
updated4
improvements4
release4
fees4
cloud4
back4
training4
console4
documentation4
tutorials4
marketplace4
04
14
features4
its4
dead4
mobile4
coming4
beta3
gamelift3
canvas3
than3
around3
which3
ever3
best3
here3
built3
another3
contact3
account3
products3
pricing3
network3
overview3
download3
we3
developers3
engine3
available3
no3
seat3
integration3
your3
use3
every3
editor3
our3
help3
twitch3

Who hosts Amazonlumberyard.us?

Amazonlumberyard.us Hosting Provider Information

Hosted IP Address:94.199.146.85
Hosted Hostname:94.199.146.85
Service Provider:City LifeLine Limited
Hosted Country:United KingdomGB
Location Latitude:51.4964
Location Longitude:-0.1224
Webserver Software:CloudFront

Is "City LifeLine Limited" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
City LifeLine Limited
0.0028%

HTTP Header Analysis for Amazonlumberyard.us

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: CloudFront
Date: Thu, 29 Oct 2020 19:21:06 GMT
Content-Type: text/html
Content-Length: 183
Connection: keep-alive
Location: https://aws.amazon.com/lumberyard
X-Cache: Redirect from cloudfront
Via: 1.1 b3f54d3c6a628831461cdc9d5d466584.cloudfront.net (CloudFront)
X-Amz-Cf-Pop: LHR52-C1
X-Amz-Cf-Id: eXhqieaqmAshB0JZ3ERylAIrBhdfd7sQh_RcOdWbUhszOPxHETZunQ==

Amazonlumberyard.us Domain Nameserver Information

HostIP AddressCountry
nsgbr.comlaude.co.uk 212.95.244.211
nsusa.comlaude.net 64.147.99.10
nssui.comlaude.ch 193.193.167.97


Need to find out who hosts Amazonlumberyard.us?


Domain Registration (WhoIs) information for Amazonlumberyard.us

 Domain Name: amazonlumberyard.us
Registry Domain ID: D52190014-US
Registrar WHOIS Server: whois.comlaude.com
Registrar URL: www.comlaude.com
Updated Date: 2020-09-01T15:52:41Z
Creation Date: 2016-02-09T04:42:04Z
Registry Expiry Date: 2022-02-08T23:59:59Z
Registrar: Nom-iq Ltd. dba COM LAUDE
Registrar IANA ID: 470
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +44.2074218250
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: C47FD3FAA620C4F699599A44DA01DAE6B-ARI
Registrant Name: Amazon Technologies, Inc.
Registrant Organization: Amazon Technologies, Inc.
Registrant Street: P.O. Box 8102
Registrant Street:
Registrant Street:
Registrant City: Reno
Registrant State/Province: Nevada
Registrant Postal Code: 89507
Registrant Country: US
Registrant Phone: +1.2062664064
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Application Purpose: P1
Registrant Nexus Category: C21
Registry Admin ID: C44039C8B7EAC420287443BE3A6049CFC-ARI
Admin Name: Amazon Technologies, Inc.
Admin Organization: Amazon Technologies, Inc.
Admin Street: PO BOX 8102
Admin Street: Attn: Trademarks
Admin Street:
Admin City: Reno
Admin State/Province: Nevada
Admin Postal Code: 89507
Admin Country: US
Admin Phone: +1.2062664064
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Application Purpose: P1
Admin Nexus Category: C21
Registry Tech ID: C2224A6EB96D94B85AD2156ECD3E000A0-ARI
Tech Name: Technical Manager
Tech Organization: Com Laude
Tech Street: 28-30 Little Russell Street
Tech Street:
Tech Street:
Tech City: London
Tech State/Province: London
Tech Postal Code: WC1A 2HN
Tech Country: GB
Tech Phone: +44.2074218250
Tech Phone Ext:
Tech Fax: +44.8700118187
Tech Fax Ext:
Tech Email: Login to show email
Application Purpose: P1
Tech Nexus Category: C31/GB
Name Server: nsgbr.comlaude.co.uk
Name Server: nsusa.comlaude.net
Name Server: nssui.comlaude.ch
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-10-01T08:45:36Z

Websites with Similar Names

Amazo-check1.club
Bitly | Page Not Found | 404
Amazo-tech.com
Laptops-Tablets
Amazo.co.uk
amazo.co.uk - Books Resources and Information.
Amazo.life
抱歉,站点已暂停
Amazo.space
Amazo.Space | Online Shopping Made Easy.
Amazo.website
amazo.website - Registered at Namecheap.com
Amazoaman.com
amazoaman.com

Recently Updated Websites

Conpabartist.top (2 seconds ago.)Chvanov.ru (6 seconds ago.)Camorigs.com (6 seconds ago.)Bomegi.xyz (9 seconds ago.)Dble-22.top (12 seconds ago.)Chodichvu.vip (16 seconds ago.)Contact.style (22 seconds ago.)Micbiocredad.top (23 seconds ago.)Thebrilliant.tech (24 seconds ago.)16wr.top (33 seconds ago.)Appleid-supports.website (37 seconds ago.)14qd.top (43 seconds ago.)13qn.top (47 seconds ago.)14yf.top (56 seconds ago.)13rn.top (58 seconds ago.)14zf.top (1 minute ago.)Makerotsurabaya.top (1 minute ago.)10gd.top (1 minute 1 second ago.)2007followingconsultations.top (1 minute 4 seconds ago.)12lw.top (1 minute 10 seconds ago.)14lm.top (1 minute 14 seconds ago.)14zm.top (1 minute 21 seconds ago.)Themeatking.com (1 minute 23 seconds ago.)16fs.top (1 minute 24 seconds ago.)Piliconle.top (1 minute 26 seconds ago.)Onlinem1.xyz (1 minute 28 seconds ago.)13zs.top (1 minute 34 seconds ago.)16sj.top (1 minute 37 seconds ago.)15nj.top (1 minute 38 seconds ago.)16mg.top (1 minute 40 seconds ago.)

Recently Searched Keywords

livet (5 seconds ago.)sin (6 seconds ago.)网友投稿 (6 seconds ago.)november has come – 11 (7 seconds ago.)famososexpress (7 seconds ago.)me_we (13 seconds ago.)收藏 (13 seconds ago.)bak (15 seconds ago.)frp (19 seconds ago.)arbeidet (20 seconds ago.)osv (22 seconds ago.)hipp (23 seconds ago.)drapene (25 seconds ago.)debatt (29 seconds ago.)nobels krigspris (32 seconds ago.)pga (34 seconds ago.)历史机票价格查询 (34 seconds ago.)odvar (34 seconds ago.)pandownload凉了,还有哪些软件可以替代?油猴脚本 网盘直链助手 idm:不限速下载百度网盘文件6月前 1273 (35 seconds ago.)jiankunzs (40 seconds ago.)34 c (45 seconds ago.)kupp-regjeringens 80 år med vanstyre- må tilbakeføres 1939. (45 seconds ago.)nn 34 kyt (45 seconds ago.)tv- (46 seconds ago.)festival of the lost 2020 (46 seconds ago.)finner du (47 seconds ago.)структура та органи управління (47 seconds ago.)destiny vinyl figure bundle $ 64.97 $ 51.77 (48 seconds ago.)arrangement (50 seconds ago.)2 beyond light (51 seconds ago.)